[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58283.1
DDBJ      :             Aerobactin siderophore biosynthesis protein IucB
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  126/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->268 2qmlA PDBj 4e-18 36.1 %
:HMM:SCOP  69->267 1yk3A1 d.108.1.1 * 1.3e-53 38.6 %
:RPS:PFM   106->149 PF10331 * AlcB 1e-06 36.4 %
:HMM:PFM   104->150 PF10331 * AlcB 5.8e-19 38.3 47/48  
:BLT:SWISS 43->270 IUCB_ECOLX 8e-46 38.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58283.1 GT:GENE ABA58283.1 GT:PRODUCT Aerobactin siderophore biosynthesis protein IucB GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2053782..2054606) GB:FROM 2053782 GB:TO 2054606 GB:DIRECTION - GB:PRODUCT Aerobactin siderophore biosynthesis protein IucB GB:PROTEIN_ID ABA58283.1 GB:DB_XREF GI:76883602 LENGTH 274 SQ:AASEQ MIDKKKLRVNDILLDKEKEEFLKNKFIPDVKEAEIKPGDKKTIISRNEFFQIPPYWLMNPERGLYPVVWTETNRVSHPIRHNPERGTLLYKRFVYEIDKTISFRVIDPKNDIDTFSRWHNQPRISEFWELKDTRENHLQYIEKNLNDPHIIPVILDINDEPTGYFELYWVKEDRLGAYYESGDFDRGFHFLIGEKKFLGLKNTGAMLKSVIHYLFLDEPRTLKIMAEPRSDNKKVLKYVDFLPFWKRIKEFDFPHKRAVLLECTRERFFTGGYL GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 43->270|IUCB_ECOLX|8e-46|38.7|225/315| BL:PDB:NREP 1 BL:PDB:REP 90->268|2qmlA|4e-18|36.1|166/184| RP:PFM:NREP 1 RP:PFM:REP 106->149|PF10331|1e-06|36.4|44/48|AlcB| HM:PFM:NREP 1 HM:PFM:REP 104->150|PF10331|5.8e-19|38.3|47/48|AlcB| HM:SCP:REP 69->267|1yk3A1|1.3e-53|38.6|197/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 270 OP:NHOMOORG 185 OP:PATTERN -------------------------111---------------------------------------- ----1-------1-11111-11--111111111111------------------------11----1211------------1------------------1----1--------------------------------------------------------2---21-----------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------1---1----1----1--111-1-1-211-------------------------1-------------------------------------------222222-----22-2------21-1-1--------1--1---1-------------------1---2---------------------------------------------------------------------------------------1---1---------11--------1---1-------1-1-11-11--------1---1--1--------------111-1111---11111111111---1----------1------------------1112112---11--1-1-1-11111----1---------111------------------------------------------------------------------------------------ --------------1-2224222222222122222233323332222233444422232222------------------------11----211------12-------------------------------------------------------------------------------------12--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 65.0 SQ:SECSTR #########################################################################################EEEEETTTTEEEEEEEcc#GGGHHHHHHHTcTHTTHHHHcccccHHHHHHHHHHHHTcTTEEEEEEEETTEEEEEEEEEEGGGcGGGGGccccTTcEEEEEEEccGGGccccTHHHHHHHHHHHHHHTcTTccEEEEcccTTcHHHHHHTTcEEccEEEEEEEccccEEEEEEEEHHHH###### DISOP:02AL 1-5| PSIPRED ccccHHEEHHHEEEEcccHHHcHHHHcccccHHHcccccccEEEEEccccccccccccccccccccEEEEccccEEcccccccccccEEEEccccccccEEEEEEccHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHccccccEEEEEEccEEEEEEEEEEEcccccccEEccccccEEEEEEEccHHHccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEEcHHHHcccccc //