[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58292.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   81->98 PF00400 * WD40 0.00082 38.9 18/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58292.1 GT:GENE ABA58292.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2067598..2068065) GB:FROM 2067598 GB:TO 2068065 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58292.1 GB:DB_XREF GI:76883611 LENGTH 155 SQ:AASEQ MKSITLLLLVGLGGFVLYGNAYALNAHAYNGSYCDNYHGAEVGDFTRGFNGIKNNANAGRYISCPVLVDESGNIDGTDKVALYYTGTGTVSCVLFSQNADGSTRQSRTASRTNSGWLSIPNITDDDYWGSYSMYCYLPPQGVLNTIWVGETNVNR GT:EXON 1|1-155:0| SEG 6->19|llllvglggfvlyg| HM:PFM:NREP 1 HM:PFM:REP 81->98|PF00400|0.00082|38.9|18/39|WD40| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 99-113, 154-155| PSIPRED cccEEEEEEEccccEEEEccEEEEEEEEccccccccccccccccHHHcccccccccccccEEEEEEEEEcccccccccEEEEEEEcccEEEEEEEEcccccccccccccccccccEEEccccccccccccEEEEEEEcccccEEEEEEccccccc //