[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58319.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->36 PF07704 * PSK_trans_fac 0.0002 34.5 29/82  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58319.1 GT:GENE ABA58319.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2104621..2104866) GB:FROM 2104621 GB:TO 2104866 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58319.1 GB:DB_XREF GI:76883638 LENGTH 81 SQ:AASEQ MISLKAQAAASGVTLAQLIGDALRESLSRRERVEERGRVQIITEKGTGTYPGIDLDHSPSLNKEFLRFPGLRARHPFRKTL GT:EXON 1|1-81:0| SEG 23->39|lreslsrrerveergrv| HM:PFM:NREP 1 HM:PFM:REP 8->36|PF07704|0.0002|34.5|29/82|PSK_trans_fac| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 27-36, 79-81| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHcccccccccccccc //