[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:318 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 19->102 MNMA_RHILW 8e-05 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58328.1 GT:GENE ABA58328.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2116794..2117750) GB:FROM 2116794 GB:TO 2117750 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58328.1 GB:DB_XREF GI:76883647 LENGTH 318 SQ:AASEQ MAIFDETRYLERLQFFNGQRLLASDLQGIETFNREMRWLHNKSLHQPGIGSGFAIYGKKGNRKVTINPGYAIDALGREIVLTQSQEEPIPPISAEGDGKSVFYDLTVSYPDNSGLEETETREGICLPRGVVRLQEAPVFCWVRLQRDGQENLRVKNSKIKEDIKNGLKIVLARIEVFNCQLKQDPSIAQRRNARPAKQPYIACGQVLPEWEFPDSQNQQEQFPLKLKATIETTKAGFLIPPCYSARIEGSRTVEIKTNKSPPDTTLFLVEFMHIEERKAEEFTVEDFVCISGIQQEHEEKVKDHIRSNWNIVWMGVEG GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 19->102|MNMA_RHILW|8e-05|32.1|84/399| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 151-152, 154-157, 185-194| PSIPRED ccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccEEEEEcccEEEEEccccEEEcccccccccEEEEcccccEEEEEEEEEEcccccccHHHHHcccccccHHHEEEcccEEEEEEEEcccccccEEcHHHHHHHHHHHHHHHHHHHHEEEEEEcccccHHHHcccccccccccHHHccccccccccccccHHHccEEEEEEEEEccccEEccccccccccccEEEEEEEcccccccEEEEHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcc //