[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58333.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->14 PF05488 * PAAR_motif 0.00026 45.5 11/25  
:HMM:PFM   26->37 PF05488 * PAAR_motif 9.3e-06 66.7 12/25  
:HMM:PFM   64->83 PF05488 * PAAR_motif 6.3e-07 60.0 20/25  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58333.1 GT:GENE ABA58333.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2124399..2124722) GB:FROM 2124399 GB:TO 2124722 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58333.1 GB:DB_XREF GI:76883652 LENGTH 107 SQ:AASEQ MPTAARIGDMTSHGTPLTPLVPGVMGSLNVFIGGQPAWRAITDVHVCPVSNGPQPHVGGTVLKGSTSVFINAFPAARQGDEIVEGGGGLTKSPWDFPLFRLEDKRDE GT:EXON 1|1-107:0| HM:PFM:NREP 3 HM:PFM:REP 4->14|PF05488|0.00026|45.5|11/25|PAAR_motif| HM:PFM:REP 26->37|PF05488|9.3e-06|66.7|12/25|PAAR_motif| HM:PFM:REP 64->83|PF05488|6.3e-07|60.0|20/25|PAAR_motif| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1---------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 104-107| PSIPRED cccccccccccccccccccccEEEcccccEEEccEEEEEEcccEEEcccccccccccccEEEEccccEEEccccEEEEccEEccccEEEEccccEEEEEEEcccccc //