[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58346.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->85 PF12445 * FliC 0.00026 58.3 24/129  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58346.1 GT:GENE ABA58346.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2139693..2139950) GB:FROM 2139693 GB:TO 2139950 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58346.1 GB:DB_XREF GI:76883665 LENGTH 85 SQ:AASEQ MPDHNEEELAAVANAIKHYFDAHPNAADSVEGIARWWLTRQRFKEATETIEKALECLVAEGEVTKMVTGEGKFVYSYAKGKMTRD GT:EXON 1|1-85:0| HM:PFM:NREP 1 HM:PFM:REP 59->85|PF12445|0.00026|58.3|24/129|FliC| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 83-85| PSIPRED cccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHEEEEccccEEEEEcccccccc //