[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58362.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->56 PF11691 * DUF3288 0.00011 19.4 31/90  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58362.1 GT:GENE ABA58362.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2165710..2166006 GB:FROM 2165710 GB:TO 2166006 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58362.1 GB:DB_XREF GI:76883681 LENGTH 98 SQ:AASEQ MSLEGGAFSFPLFRAGGKREKQIIASKDINRIMKDWSLKIADVNKAVDQLYTQCSIFIPVTPRTPFLQGEEDVKNIPYSAADDTFPTKSAFLAVNIIS GT:EXON 1|1-98:0| HM:PFM:NREP 1 HM:PFM:REP 26->56|PF11691|0.00011|19.4|31/90|DUF3288| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccccHHccccccccHHHHHHHHHHHHHHHHcEEEEHHHHHHHHHHHHEEEEEEEccccccccccHHHHHccccccccccccccEEEEEEEEc //