[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58368.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->89 PF00435 * Spectrin 0.00091 19.4 62/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58368.1 GT:GENE ABA58368.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2176196..2176474 GB:FROM 2176196 GB:TO 2176474 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58368.1 GB:DB_XREF GI:76883687 LENGTH 92 SQ:AASEQ MFLQKSGSGSKAAHFLYKFKVLSALQREYEDIIQNAKQNLHDLNLDQEQFHEEESHYLQRHLLLVERKEITTAFHQVLVDIDVRLLELESER GT:EXON 1|1-92:0| HM:PFM:NREP 1 HM:PFM:REP 26->89|PF00435|0.00091|19.4|62/105|Spectrin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 90-92| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccc //