[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58372.1
DDBJ      :             conserved hypothetical protein, RDD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->135 PF06271 * RDD 1e-04 27.6 %
:HMM:PFM   12->135 PF06271 * RDD 1.1e-27 29.0 124/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58372.1 GT:GENE ABA58372.1 GT:PRODUCT conserved hypothetical protein, RDD GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2183538..2184002 GB:FROM 2183538 GB:TO 2184002 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein, RDD GB:PROTEIN_ID ABA58372.1 GB:DB_XREF GI:76883691 InterPro:IPR010432 LENGTH 154 SQ:AASEQ MKATNHHLPSTPGLFRRLGAIFYDSLLLIATWFLFTIFALPLTAGEAIPAGNILYRLYLLLIALAFFGGFWTHGGQTLGMRAWRIKVQQPNGQLITWRQVLLRFGSAFLSWLPLGAGFWWVFIDKEGQAWHDRLSITTLVLVPKKTKVNKSGAA GT:EXON 1|1-154:0| TM:NTM 3 TM:REGION 18->40| TM:REGION 51->73| TM:REGION 99->121| SEG 53->69|ilyrlylllialaffgg| RP:PFM:NREP 1 RP:PFM:REP 13->135|PF06271|1e-04|27.6|123/132|RDD| HM:PFM:NREP 1 HM:PFM:REP 12->135|PF06271|1.1e-27|29.0|124/133|RDD| OP:NHOMO 57 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--------111-11----------------------------------------------------------------1-1---1-------1111-1-11-----1-1--------------------------------------------------------------------------------------------------------11---------------------------1111111111111111-----------------------1-1111-1111111-1111--------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 147-154| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccEEEEccccccccccccc //