[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58377.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:426 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  350->422 1r7jA_ a.4.5.49 * 2.4e-05 30.1 %
:HMM:PFM   65->233 PF03486 * HI0933_like 0.0008 17.4 161/409  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58377.1 GT:GENE ABA58377.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2190554..2191834 GB:FROM 2190554 GB:TO 2191834 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58377.1 GB:DB_XREF GI:76883696 LENGTH 426 SQ:AASEQ MTPASDTAPLWRYLRLNDFTSPSPTTKETVRKGVTELWHKLMGDSKSEEPIRAQDELKSLSDELYAQIAPEPDWTELVTALNEALEKGLTTRVSQAQIVVGAPFSGITETLEHWAKHRGIKIIKPPSPETILNQEQQWLQRLEEEGSARPLVISHLERCYLRHHHGLKLIRQLLQWLSTRPGYCVLGCSSWAWAYFSKALQAEKLFSIPWTLGALNQERLQQWFSNLNTSQQQETFIFRQLDNGDFVIPPSRDDSFTKRTTQKRFTSVSVDSDDTARTEASTFLTDLAAYSRGNPGVAWALWRQSLQGVPETKNDDHDHASDLDKPTQNHTIWVKPWSQIQHLALSESADRSTLQILHTLLLHGPLPASLLIELLPLSGFEIRRILTYLEYRNFLISARGQWQLTPLGYPAVRQALEEEGYLLDSL GT:EXON 1|1-426:0| SEG 132->145|lnqeqqwlqrleee| SEG 360->377|lllhgplpaslliellpl| HM:PFM:NREP 1 HM:PFM:REP 65->233|PF03486|0.0008|17.4|161/409|HI0933_like| HM:SCP:REP 350->422|1r7jA_|2.4e-05|30.1|73/90|a.4.5.49|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------------------------------1--1-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 43-59| PSIPRED cccccccHHcEEEEEEccccccccccHHHHHHHHHHHHHHHccccHHccccccHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccEEEEEccccHHHccccHHHHHccccccccccEEEccHHHHHHccccHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHcccEEcccccccccccHHHHHHHHHcccccccccccEEEEccccHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHccccccHHHHccccccccEEEccHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHcccccccc //