[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58385.1
DDBJ      :             Abortive infection protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   129->217 PF02517 * Abi 2.3e-17 33.0 88/99  
:HMM:PFM   93->155 PF09771 * Tmemb_18A 0.00052 18.3 60/126  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58385.1 GT:GENE ABA58385.1 GT:PRODUCT Abortive infection protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2198135..2198833) GB:FROM 2198135 GB:TO 2198833 GB:DIRECTION - GB:PRODUCT Abortive infection protein GB:PROTEIN_ID ABA58385.1 GB:DB_XREF GI:76883704 InterPro:IPR003675 LENGTH 232 SQ:AASEQ MNRRQAWIDIIFALILVGVSAIAVGLISAFMGQHQFFLLLALQGIAILLGLRFLLAVRGQSWRHLGLQVLTLKDLGRALIGFVSCMGANMVLTTLVFITDTQSLKQHVDALKIIGTQLSSEISFAGIAALMFFVGVYEEIMARGFLLARCRLALGGLWGPVLLSSFLFGLGHLYQGWIGVAQTTLFGIVLAILTVRWGTLWPAIFAHAMLNIFSLAILEQFAEQSSFSIFQF GT:EXON 1|1-232:0| TM:NTM 6 TM:REGION 8->30| TM:REGION 37->59| TM:REGION 79->101| TM:REGION 122->144| TM:REGION 151->173| TM:REGION 180->202| SEG 35->51|qfflllalqgiaillgl| SEG 142->157|argfllarcrlalggl| SEG 162->171|llssflfglg| HM:PFM:NREP 2 HM:PFM:REP 129->217|PF02517|2.3e-17|33.0|88/99|Abi| HM:PFM:REP 93->155|PF09771|0.00052|18.3|60/126|Tmemb_18A| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //