[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58413.1
DDBJ      :             FAD linked oxidase-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  160/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
d.145.1
:452 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->180 2vfuA PDBj 7e-10 27.1 %
:RPS:PDB   3->438 3bw7A PDBj 2e-37 13.5 %
:RPS:SCOP  42->180 1w1oA2  d.145.1.1 * 5e-26 25.2 %
:HMM:SCOP  38->181 1w1oA2 d.145.1.1 * 1e-35 35.4 %
:RPS:PFM   22->144 PF01565 * FAD_binding_4 7e-11 34.1 %
:RPS:PFM   383->446 PF04030 * ALO 1e-08 35.9 %
:HMM:PFM   38->150 PF01565 * FAD_binding_4 2.4e-23 33.9 112/138  
:HMM:PFM   385->445 PF04030 * ALO 3.1e-10 31.1 61/260  
:BLT:SWISS 84->236,317->448 YMP4_STRCO 6e-20 42.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58413.1 GT:GENE ABA58413.1 GT:PRODUCT FAD linked oxidase-like GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2234969..2236327) GB:FROM 2234969 GB:TO 2236327 GB:DIRECTION - GB:PRODUCT FAD linked oxidase-like GB:PROTEIN_ID ABA58413.1 GB:DB_XREF GI:76883732 InterPro:IPR006094 LENGTH 452 SQ:AASEQ MAASLSKTISGWGRYPVAESILIRPEKMPQACVLGEEHLICRGQGRSYGDAAISSQGRVILTERLNRFLAFDNATGVLTAEAGVTLAEILETFVPRGWFPPVTPGTQYVSLGGTVAADVHGKNHHHKEAFAAHVIELELILADGRRQRCSPNQNEALFWATVGGMGLTGIITEVSFRLMPIETAAIMARNYTVPDLETIFKWLEDTEHDDQYSVAWLDCAGRSRHLGRGILITGHHAVRDELPGDWEEPLCSHPKRQKSVPFNLPPFILNRVTIAAFNEFYYHRQGSKKAPFLTDYSAFFYPLDTLAHWNRLYGKRGFLQYQAAIPEPHAYEGIRCLLEYLARNRQASFLAVLKRLGPGNIAPLSFPLAGYTLALDLPMGGEKVLNLLQQLDEIVIDYGGRVYLAKDARLSPESLRAMYPRLGEWQQVKQVIDPEERFQSDLSRRLQLTGAP GT:EXON 1|1-452:0| BL:SWS:NREP 1 BL:SWS:REP 84->236,317->448|YMP4_STRCO|6e-20|42.3|281/367| BL:PDB:NREP 1 BL:PDB:REP 8->180|2vfuA|7e-10|27.1|170/414| RP:PDB:NREP 1 RP:PDB:REP 3->438|3bw7A|2e-37|13.5|430/497| RP:PFM:NREP 2 RP:PFM:REP 22->144|PF01565|7e-11|34.1|123/139|FAD_binding_4| RP:PFM:REP 383->446|PF04030|1e-08|35.9|64/259|ALO| HM:PFM:NREP 2 HM:PFM:REP 38->150|PF01565|2.4e-23|33.9|112/138|FAD_binding_4| HM:PFM:REP 385->445|PF04030|3.1e-10|31.1|61/260|ALO| GO:PFM:NREP 5 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003885|"GO:D-arabinono-1,4-lactone oxidase activity"|PF04030|IPR007173| GO:PFM GO:0016020|"GO:membrane"|PF04030|IPR007173| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04030|IPR007173| RP:SCP:NREP 1 RP:SCP:REP 42->180|1w1oA2|5e-26|25.2|139/206|d.145.1.1| HM:SCP:REP 38->181|1w1oA2|1e-35|35.4|144/206|d.145.1.1|1/1|FAD-binding domain| OP:NHOMO 230 OP:NHOMOORG 215 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-12111111111122221111----1-1------------------13-111-------------1--------------1-----1--------------------1-------1-----------1---11---------1---1---1--1---------------------11111111-111111------111-----1--------------------------------------------------------------------------------------------------------------------11----1-----------------------------1--------11--1----2---11-11111-11-------1--2------111-1-111-----1--1-----------------1--------------------------------1-----111111111111----1111------111---1-1--1--2--11---1--1-----1------------1-11-------------------------1--1--------------------1---2------1----------------------------1-------------------------------------------------------------------------------------------------1--111111-1-------------------------------1-------------1------------------------111-------------1-111111------------------------------------------------- ---------------11-11111111111111111111---1-11111111111---2-111------------------------11---211-1-----1-1-1------------------------------1------------------111-----1------------------------112-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 439 STR:RPRED 97.1 SQ:SECSTR ##HHHHTcccTTccccccccEEEcccHHHHHcTTccccEEEEccccccccTTccTTcEEEEGGGGGccccccTTccEEEEETTccHHHHHHHHHTTTEEEccccccccccHHHHHTTccccTTHHHHccGGGcEEEEEEEETTccEEEEEccccHHHHHHHTTcTTccEEEEEEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEGGGHHHHHHTTccccHHHHHHHHHHHHHTccEEEEEEEEEEcccTTHHHHHHHHHHHHHHTccccTTcEEEEEEEHHHHHTHHHHccccccEEEEEEGGGHHHHHHHcccccTTTcccEEEEEEEGGGccTTcccccccccEEEEEEEccccHHHHHHHHHHHHHHHHTTcccEEcccccccHHHHHHHHHHHHHHHHHHHHHcTTcccTTT########### DISOP:02AL 1-2, 451-452| PSIPRED cccccccccccccccccccEEEEEEHHHHHHHHHcccEEEEEEccccccccEEccccEEEEHHHccEEEEEEccccEEEEEccccHHHHHHHHHHcccEEcccccccccccccccccccccccccccccHHHEEEEEEEEcccccEEEccccccHHHHHHHHHccccEEEEEEEEEEEEEccHHHEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEcccccccccHHHHHHHHHccccHHHHHHcccccHHccccHHHHHHHHHHHHccccHHHHEEcccHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHcccEEccccccccHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHccccc //