[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58414.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->104 PF03085 * RAP-1 2e-04 34.0 %
:HMM:PFM   222->240 PF07589 * VPEP 5.7e-07 57.9 19/25  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58414.1 GT:GENE ABA58414.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2236888..2237652 GB:FROM 2236888 GB:TO 2237652 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58414.1 GB:DB_XREF GI:76883733 LENGTH 254 SQ:AASEQ MVFELDAFLNIKGLDLNGGTVIGTSAQFSFDALPPGLTFGFSSSLSSDLSNLALTYTLSNSTTAKIFPEVTFFSFLDGDIADFDIREIFETLTPQELLEISLNDFAEASGILGSGASDSDPDSWEIDEPEFLFGDIFNNLLLGALDNSNAIPISFPEDASLALGFNLGDLNPFETATIDVFLSESGNSIGNFFLTQRDLNPNSFTSITMSGQSSVKQNPIPPIPEPPTWLLLTAGLAALKLSWQLKMDSTNPTL GT:EXON 1|1-254:0| SEG 42->54|ssslssdlsnlal| SEG 219->227|pippipepp| SEG 230->241|llltaglaalkl| RP:PFM:NREP 1 RP:PFM:REP 55->104|PF03085|2e-04|34.0|50/237|RAP-1| HM:PFM:NREP 1 HM:PFM:REP 222->240|PF07589|5.7e-07|57.9|19/25|VPEP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-118, 210-219, 251-254| PSIPRED cEEEEEEEEEEEEEEccccEEEEccccEEEcccccccEEcccHHHHHHHccEEEEEEEccccEEEEcccEEEEEccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHEEEEcccccEEEEEccccccEEEEEcccccccccEEEEEEEEEccccccEEEEEEEcccccccEEEEEEcccccccccccccccccccEEEEEcccEEEEEEEEEEEccccccc //