[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58419.1
DDBJ      :             Orn/DAP/Arg decarboxylase 2
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  576/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
b.49.2c.1.6
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->409 2j66A PDBj 1e-47 34.2 %
:RPS:PDB   27->410 3c5qA PDBj 2e-39 25.8 %
:RPS:SCOP  47->295 1hkvA2  c.1.6.1 * 2e-33 24.5 %
:RPS:SCOP  278->410 1knwA1  b.49.2.3 * 5e-19 24.4 %
:HMM:SCOP  36->295 1twiA2 c.1.6.1 * 6.8e-66 41.7 %
:HMM:SCOP  256->410 1f3tA1 b.49.2.3 * 2.1e-32 38.3 %
:RPS:PFM   55->292 PF02784 * Orn_Arg_deC_N 2e-24 35.5 %
:RPS:PFM   338->393 PF00278 * Orn_DAP_Arg_deC 2e-04 35.7 %
:HMM:PFM   49->293 PF02784 * Orn_Arg_deC_N 1.8e-43 33.2 238/251  
:HMM:PFM   298->410 PF00278 * Orn_DAP_Arg_deC 4.7e-17 29.9 107/116  
:BLT:SWISS 12->410 DCDA_AQUAE 3e-34 31.2 %
:PROS 231->248|PS00879|ODR_DC_2_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58419.1 GT:GENE ABA58419.1 GT:PRODUCT Orn/DAP/Arg decarboxylase 2 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2243015..2244247 GB:FROM 2243015 GB:TO 2244247 GB:DIRECTION + GB:PRODUCT Orn/DAP/Arg decarboxylase 2 GB:PROTEIN_ID ABA58419.1 GB:DB_XREF GI:76883738 InterPro:IPR000183 InterPro:IPR002433 LENGTH 410 SQ:AASEQ MNTPLPHSPLDYFPIKNDCLLVGGVPLTEFAARVGSTPFYAYERRLISERIQHLRTHLPSEIYIHYALKANPMPALAGHIAPLVDGLDVASLGELRVALDTGTPPESISFAGPGKSDAELAASLAAGITINMESEGEMERIAHLAEKQGRRPRVAVRVNPNFELKTSGMKMAGGPKPFGVDAERVPAMLARINTLDLDFQGFHIFSGSQNLRAEAIIEAQERTFTLALELARSAPTPVRLLNIGGGFGIPYFPGNKPLDLRPIADNLAASLPKLQRQIPEAEVTLELGRYLVGEAGIYVCEIIDRKISRGHVFLITNGGLHHHLAASGNFGQVIRKNYPVVVGNRIQGSTREIASVVGPLCTPLDLLADRMELAQAEAGDLIVVFQSGAYGRSASPLGFLSHPVPAEVLV GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 12->410|DCDA_AQUAE|3e-34|31.2|384/420| PROS 231->248|PS00879|ODR_DC_2_2|PDOC00685| SEG 150->161|rrprvavrvnpn| SEG 242->255|nigggfgipyfpgn| BL:PDB:NREP 1 BL:PDB:REP 37->409|2j66A|1e-47|34.2|351/390| RP:PDB:NREP 1 RP:PDB:REP 27->410|3c5qA|2e-39|25.8|365/394| RP:PFM:NREP 2 RP:PFM:REP 55->292|PF02784|2e-24|35.5|234/249|Orn_Arg_deC_N| RP:PFM:REP 338->393|PF00278|2e-04|35.7|56/139|Orn_DAP_Arg_deC| HM:PFM:NREP 2 HM:PFM:REP 49->293|PF02784|1.8e-43|33.2|238/251|Orn_Arg_deC_N| HM:PFM:REP 298->410|PF00278|4.7e-17|29.9|107/116|Orn_DAP_Arg_deC| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02784|IPR000183| GO:PFM GO:0003824|"GO:catalytic activity"|PF00278|IPR000183| RP:SCP:NREP 2 RP:SCP:REP 47->295|1hkvA2|2e-33|24.5|249/265|c.1.6.1| RP:SCP:REP 278->410|1knwA1|5e-19|24.4|131/174|b.49.2.3| HM:SCP:REP 36->295|1twiA2|6.8e-66|41.7|259/0|c.1.6.1|1/1|PLP-binding barrel| HM:SCP:REP 256->410|1f3tA1|2.1e-32|38.3|141/0|b.49.2.3|1/1|Alanine racemase C-terminal domain-like| OP:NHOMO 748 OP:NHOMOORG 619 OP:PATTERN -----------------1-----1-----1---1111111-1-11111-----1---1----111--- 111-21-----1111--11-1111111111111111--1111121--1-11----1-1--32-11123121-------112211111111111112--11---111---1---------------111111112111--1-111-1--11-----11111111111------111111111111-----1111111111111111111111111111111111111111-111111111111111111-----11----1--1--------1111-1-1-------11111111111111-------------1--------1-1-1-11111111-121111111-1---1111-11121--11-112---1111111111111111111111112111111111111-22122221222113311121112211111112111111122222222-1121122----1-------------------------2222111111111121-----1121------12211221111211211-1211-1121111-11111111223222112--1-1-21112-111-1111111111211111111111111111----11111111111111311211111121111111112111---2221--------22--------------------------------------111------------------------1----------------2-1---111111111111111111111111111111212121223222112222111222----21--111111111112222--221221111111111-------------------------------------------1111-21222121 ----211-1-1-----1----1----------------------------------------------------------------------1------------------------------------------1----------------------11--------11---1----1F----1------1--1-131 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 407 STR:RPRED 99.3 SQ:SECSTR ###HHHHHHHHcEEEccTTcHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHTcccEEEEEEGGGcccHHHHHHHHHTTcEEEEccHHHHHHHHHHTccGGGEEEccTTccHHHHHHHHHTTccEEEccHHHHHHHHHHHHHHTccEEEEEEccccccccccGGGccccTTcccccHHHHHHHHHHHHHcTEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHTTccccEEEccccccccTTccccccccccccHHHHHHHHHHHHTTTcccEEEEcccHHHHTTTEEEEEEEEEEEEEccccEEEEcccTTTccHHHHHcccHccccccEEEcccccEccEEEEEEEcccccTTcEEEEEEEEEcccTTcEEEEcccccccGGGcccGTTTccccEEEEE DISOP:02AL 1-4| PSIPRED ccccccccccccEEEEccEEEEEcccHHHHHHHHccccEEEEcHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccEEEEcHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHccEEEEEEEEEEEEccccEEEEEcccccccccccccccccccccccEEccccccccccEEEEEEEcccccccEEEEEEEccccccccEEEEEccccHHEEEEcccccccccccEEEc //