[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58426.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58426.1 GT:GENE ABA58426.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2249996..2250298) GB:FROM 2249996 GB:TO 2250298 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58426.1 GB:DB_XREF GI:76883745 LENGTH 100 SQ:AASEQ MIMGFKGYFFVESLFVLRFGVQPLAEIVGLIQEAGPEIHLHLHPEWIDKLEQSLFPKRRGYLMRNFSLNEQSKLIQWGLKHLHAAGVPQVKAFRAGSFYA GT:EXON 1|1-100:0| TM:NTM 1 TM:REGION 7->29| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1111----------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEHHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEEcHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccEEEEccccccc //