[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58448.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->41 PF01385 * Transposase_2 0.00062 13.3 30/227  
:BLT:SWISS 1->42 YSNA_STRPR 2e-07 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58448.1 GT:GENE ABA58448.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2282537..2282665) GB:FROM 2282537 GB:TO 2282665 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58448.1 GB:DB_XREF GI:76883767 LENGTH 42 SQ:AASEQ MVKSSNPLNIHWNFKNGLPPEPLSITISKDAAGRYFVSMLCD GT:EXON 1|1-42:0| BL:SWS:NREP 1 BL:SWS:REP 1->42|YSNA_STRPR|2e-07|42.9|42/100| HM:PFM:NREP 1 HM:PFM:REP 8->41|PF01385|0.00062|13.3|30/227|Transposase_2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccEEEEcccccccccccEEEEEEcccccEEEEEEEc //