[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58466.1
DDBJ      :             Protein of unknown function DUF526
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  199/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->77 PF04380 * DUF526 9e-11 56.5 %
:HMM:PFM   8->78 PF04380 * DUF526 5.8e-30 62.9 70/70  
:BLT:SWISS 1->93 YQIC_ECOLI 4e-16 39.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58466.1 GT:GENE ABA58466.1 GT:PRODUCT Protein of unknown function DUF526 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2311971..2312270) GB:FROM 2311971 GB:TO 2312270 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF526 GB:PROTEIN_ID ABA58466.1 GB:DB_XREF GI:76883785 InterPro:IPR007475 LENGTH 99 SQ:AASEQ MIESKLLDELARKLAEAVPPGLQDFQRDVEKNFRAVLSSTFAKLDLVTREEFDLQQAVLARTRMKLEHLATQVASLEEQIGLSKTPQESQKAPEEKLIE GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|YQIC_ECOLI|4e-16|39.8|93/100| COIL:NAA 27 COIL:NSEG 1 COIL:REGION 53->79| RP:PFM:NREP 1 RP:PFM:REP 8->77|PF04380|9e-11|56.5|69/70|DUF526| HM:PFM:NREP 1 HM:PFM:REP 8->78|PF04380|5.8e-30|62.9|70/70|DUF526| OP:NHOMO 199 OP:NHOMOORG 199 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1111111-111111--11111111-1-1-1-----------------11---11-------1111-1-----------------------------------------------------------11111-1-1111111111111111111111---1111------11111111111111111-11111111111111111111111111-1111111111111111111111111-111111111111---1111111111111--111-1-1----1-------------------1111-1111-------------1111111111--1--11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 81-99| PSIPRED cccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHccc //