[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58470.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->70 PF09560 * Spore_YunB 0.00055 25.0 36/94  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58470.1 GT:GENE ABA58470.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2316533..2316778) GB:FROM 2316533 GB:TO 2316778 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58470.1 GB:DB_XREF GI:76883789 LENGTH 81 SQ:AASEQ MIFLAGRSLVVSPIFSSPYANFLANPGNKIEAQLGVSMRLGIFLTENLFCALTPKIILQFSSSGMRSPNASKAGPESKEVG GT:EXON 1|1-81:0| HM:PFM:NREP 1 HM:PFM:REP 35->70|PF09560|0.00055|25.0|36/94|Spore_YunB| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 62-81| PSIPRED cEEEccccEEEEcccccccHHHHcccccEEEEEEccEEEEEEEEEccEEEEEcHHHEEEEccccccccccccccccccccc //