[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58475.1
DDBJ      :             aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
Swiss-Prot:GATB_NITOC   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;         Short=Asp/Glu-ADT subunit B;         EC=6.3.5.-;

Homologs  Archaea  52/68 : Bacteria  720/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
a.182.1d.128.1
:477 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->413 3h0lB PDBj e-104 46.2 %
:RPS:PDB   2->404 2df4B PDBj e-164 46.9 %
:RPS:SCOP  2->296 2df4B2  d.128.1.5 * e-125 48.3 %
:RPS:SCOP  297->404 2df4B1  a.182.1.2 * 8e-34 43.0 %
:HMM:SCOP  4->296 2f2aB2 d.128.1.5 * 3.1e-123 60.0 %
:HMM:SCOP  297->404 2f2aB1 a.182.1.2 * 3.5e-36 57.9 %
:RPS:PFM   6->291 PF02934 * GatB_N 1e-92 54.9 %
:RPS:PFM   329->476 PF02637 * GatB_Yqey 3e-43 59.2 %
:HMM:PFM   5->291 PF02934 * GatB_N 3.7e-123 54.4 287/289  
:HMM:PFM   328->476 PF02637 * GatB_Yqey 7.9e-59 52.0 148/149  
:BLT:SWISS 1->477 GATB_NITOC 0.0 100.0 %
:PROS 144->158|PS01234|GATB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58475.1 GT:GENE ABA58475.1 GT:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2323511..2324944) GB:FROM 2323511 GB:TO 2324944 GB:DIRECTION - GB:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B GB:PROTEIN_ID ABA58475.1 GB:DB_XREF GI:76883794 InterPro:IPR003789 InterPro:IPR004413 InterPro:IPR006075 InterPro:IPR006107 LENGTH 477 SQ:AASEQ MQWEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAVDLGLPGVLPVLNQAVVRMAVKFGLAIEAKIAKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIELEDGVEKRIEIVRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSGPDLRSTKEAVTYMKKIHTLVRYLGICDGNMQEGSFRCDANISIRPQGQETLGTRTELKNINSFRFVERALQYEIERQTEVLESGGQVLQETRLFDPAKNETRPMRTKEEATDYRYFPDPDLLPLVLEDSFIDEVRETLPELPDAKRKRFVMEYALSAYDASVLTASRELADYYEAVVKTADGEAKLSANWVMGDLAGALNKEGKSIADSPVSPEQLGQLIKRIADETISGKIAKTVFETMYAQGGKADEIIARQGLKQVTDTASIEKLIDEVLAANPQQVTQYQGGKDKLFGFFVGQVMKTSKGKANPQQLNELLKKKLS GT:EXON 1|1-477:0| SW:ID GATB_NITOC SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Short=Asp/Glu-ADT subunit B; EC=6.3.5.-; SW:GN Name=gatB; OrderedLocusNames=Noc_2014; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->477|GATB_NITOC|0.0|100.0|477/477| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 144->158|PS01234|GATB|PDOC00948| SEG 42->51|lglpgvlpvl| SEG 274->285|pdpdllplvled| BL:PDB:NREP 1 BL:PDB:REP 2->413|3h0lB|e-104|46.2|409/410| RP:PDB:NREP 1 RP:PDB:REP 2->404|2df4B|e-164|46.9|399/399| RP:PFM:NREP 2 RP:PFM:REP 6->291|PF02934|1e-92|54.9|286/288|GatB_N| RP:PFM:REP 329->476|PF02637|3e-43|59.2|147/148|GatB_Yqey| HM:PFM:NREP 2 HM:PFM:REP 5->291|PF02934|3.7e-123|54.4|287/289|GatB_N| HM:PFM:REP 328->476|PF02637|7.9e-59|52.0|148/149|GatB_Yqey| GO:PFM:NREP 4 GO:PFM GO:0006412|"GO:translation"|PF02934|IPR006075| GO:PFM GO:0016874|"GO:ligase activity"|PF02934|IPR006075| GO:PFM GO:0006412|"GO:translation"|PF02637|IPR018027| GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF02637|IPR018027| RP:SCP:NREP 2 RP:SCP:REP 2->296|2df4B2|e-125|48.3|292/292|d.128.1.5| RP:SCP:REP 297->404|2df4B1|8e-34|43.0|107/107|a.182.1.2| HM:SCP:REP 4->296|2f2aB2|3.1e-123|60.0|290/0|d.128.1.5|1/1|Glutamine synthetase/guanido kinase| HM:SCP:REP 297->404|2f2aB1|3.5e-36|57.9|107/0|a.182.1.2|1/1|GatB/YqeY motif| OP:NHOMO 1042 OP:NHOMOORG 952 OP:PATTERN 11121212222222211------2111111222122222222211111111111--1--------111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111-111111111--------1--------1112111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-2111111111111-111---11211111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111211----11--------------------------11111---------------------------------------------------------------------------------------------11111111111111---------------111111111111111111111111111111111111111----------------------------11111111111111111111-----1-11111111111111111111111111111111 -1--111-1-----1111111111111111111111111111111111111111111-1111111111111111121-1111111112-1211111111-111111-1-1121112211111113-111191-1111111211211111111111111113111111111A11-11-12E2221111131421111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 469 STR:RPRED 98.3 SQ:SECSTR cccEEEEEEEEEEEccccccccccccccccccTTccccTTTTTcTTccccccHHHHHHHHHHHHTTTcEEccEEccEEEEcccTTcTTcEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEEEcccEEEccTTccEEEEETTcTTcEEEEEEEcTTcccHHHHHHHHHHHHHHHHHHTcccccTTTTcEEEEEEEEEEcTTccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTTccEEEEEEcccccccccEEcTTcccEEccHHHHHHHHHTccccHHHHHTTTTcTTccccHHHHHHcccHHHHHHHHHHHHHHTccHHHHHHHHHTTHHHHHHHHTcccTTTcccHHHHHHHHHHHHTTcccGGGHHHHHHHHHHcccccTTHHHTTccccEcHHHHHHHHHTTcTTTcccHHHHHTTTTTHHHHHHHTTcc###cccGGGHHHHHHH##### PSIPRED ccccEEEEEEEEEEEcccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHccEEccEEEEEEEEEEcccccccHHHHHHccccccccEEEEEcccccEEEEEEEEEEEcHHHHHHcccccccEEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccEEEEccccccccccccccccccccEEEcHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHcccEEcccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHc //