[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58496.1
DDBJ      :             Exodeoxyribonuclease VII small subunit
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  298/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.13
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->62 1vp7E PDBj 7e-13 57.4 %
:RPS:SCOP  6->68 1vp7A  a.7.13.1 * 4e-11 49.2 %
:HMM:SCOP  1->75 1vp7B_ a.7.13.1 * 7.7e-20 46.7 %
:RPS:PFM   9->59 PF02609 * Exonuc_VII_S 2e-06 66.7 %
:HMM:PFM   9->61 PF02609 * Exonuc_VII_S 5.5e-26 62.3 53/53  
:BLT:SWISS 4->76 EX7S_METCA 1e-17 53.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58496.1 GT:GENE ABA58496.1 GT:PRODUCT Exodeoxyribonuclease VII small subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2347720..2347953 GB:FROM 2347720 GB:TO 2347953 GB:DIRECTION + GB:PRODUCT Exodeoxyribonuclease VII small subunit GB:PROTEIN_ID ABA58496.1 GB:DB_XREF GI:76883815 InterPro:IPR003761 LENGTH 77 SQ:AASEQ MPKRNKLDFESALAELETLVSRMEQGEVSLEESLRLYERGVKLSQLCQETLRDAEQKVQILQQKQGKEQINDFPNEE GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 4->76|EX7S_METCA|1e-17|53.4|73/76| BL:PDB:NREP 1 BL:PDB:REP 8->62|1vp7E|7e-13|57.4|54/66| RP:PFM:NREP 1 RP:PFM:REP 9->59|PF02609|2e-06|66.7|51/53|Exonuc_VII_S| HM:PFM:NREP 1 HM:PFM:REP 9->61|PF02609|5.5e-26|62.3|53/53|Exonuc_VII_S| GO:PFM:NREP 3 GO:PFM GO:0006308|"GO:DNA catabolic process"|PF02609|IPR003761| GO:PFM GO:0008855|"GO:exodeoxyribonuclease VII activity"|PF02609|IPR003761| GO:PFM GO:0009318|"GO:exodeoxyribonuclease VII complex"|PF02609|IPR003761| RP:SCP:NREP 1 RP:SCP:REP 6->68|1vp7A|4e-11|49.2|63/68|a.7.13.1| HM:SCP:REP 1->75|1vp7B_|7.7e-20|46.7|75/0|a.7.13.1|1/1|XseB-like| OP:NHOMO 300 OP:NHOMOORG 299 OP:PATTERN -------------------------------------------------1------------------ 11--------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------111111111111111------1111-1-1-1111111-1-111111111111-111111-----------------1----------------------------------------------------1----1111111-1----------------------------1---1-----------1--1111111-11111111111111111---1--1----1-1111111111--111111-11111-11--------1-----1----------------------------------1-1111-111111-----1111------111-1-1------------------111111--------111-111-----------------------------11---------------------------11-1-1--1111111-11111111-1-111---1-1-------111111-1111111-11-1111111111111111111111----11111111111111111-11111111-111111111111--1111111-1-1111-11111-1-11111--1----------21--1--111----1-111----------1111-----111----------------11--111111-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 71.4 SQ:SECSTR #######cHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH############### DISOP:02AL 1-2, 63-77| PSIPRED ccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //