[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58519.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->140 PF09990 * DUF2231 1e-13 27.1 96/104  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58519.1 GT:GENE ABA58519.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2368493..2368936 GB:FROM 2368493 GB:TO 2368936 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58519.1 GB:DB_XREF GI:76883838 LENGTH 147 SQ:AASEQ MTGLRLGGAPVHPMLVHFPIVAWTTALLADGVFLITGQPSAWIVAYWALAAGALTGLAAMVPGWVDFLLLDRTHTALPAVQRHMLYMSTAWGIFLLDLLVRTRVPPETMPVWLAGLSLAGFVLLAIGSHRGARLVYYHGVNVYRDPV GT:EXON 1|1-147:0| TM:NTM 3 TM:REGION 13->35| TM:REGION 46->68| TM:REGION 96->118| SEG 48->59|alaagaltglaa| HM:PFM:NREP 1 HM:PFM:REP 44->140|PF09990|1e-13|27.1|96/104|DUF2231| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 144-147| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccc //