[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58522.1
DDBJ      :             glucose-6-phosphate 1-dehydrogenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  651/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:507 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->498 1h93A PDBj 3e-79 34.4 %
:RPS:PDB   10->497 2dpgA PDBj e-131 33.1 %
:RPS:SCOP  9->199 1dpgA1  c.2.1.3 * 1e-56 27.3 %
:RPS:SCOP  187->497 1qkiA2  d.81.1.5 * e-108 36.3 %
:HMM:SCOP  2->207 1qkiA1 c.2.1.3 * 4.1e-55 43.0 %
:HMM:SCOP  187->498 1qkiA2 d.81.1.5 * 2.7e-147 57.9 %
:RPS:PFM   15->197 PF00479 * G6PD_N 7e-41 46.7 %
:RPS:PFM   199->497 PF02781 * G6PD_C 3e-97 58.6 %
:HMM:PFM   199->498 PF02781 * G6PD_C 2.9e-107 44.0 291/294  
:HMM:PFM   15->197 PF00479 * G6PD_N 6e-59 42.3 182/183  
:BLT:SWISS 11->497 G6PD_SYNY3 e-128 47.0 %
:PROS 187->193|PS00069|G6P_DEHYDROGENASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58522.1 GT:GENE ABA58522.1 GT:PRODUCT glucose-6-phosphate 1-dehydrogenase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2371354..2372877 GB:FROM 2371354 GB:TO 2372877 GB:DIRECTION + GB:PRODUCT glucose-6-phosphate 1-dehydrogenase GB:PROTEIN_ID ABA58522.1 GB:DB_XREF GI:76883841 InterPro:IPR001282 LENGTH 507 SQ:AASEQ MMESHSSQQPPTVFVLFGAGGDLAWRLILPALFNLYLDKSLPQQWMLMGIDRQDYDQHSLAQHYRKGIQQHSRRPIPDEKTWQSFAQLLRYHQADITDPGSYTQLAKALAEQDKAWHGKAERVFYLATPPFLFADLANGLGEAGLAKERQHARVVVEKPLGHNLESFCEINQALNHHFEESQIYRMDHFLGKETVQNILALRFANPIFEPIWNRRYIDHIAITAAETLGVEHRAGYYERAGALRDMVQNHLLQLLCLVAMEPPIAFNAYDLRDRRMDLMHAIRPITEEEVGRYAARGQYGAGWIRGTQVPAYREEDEVAPDSNTETYCALELHIDNWRWQGVPFYLRTGKRLPVDASEISIRFQEVPHQAFPASAGLNAQPAQLVIRLQPEEGIVLRFMAKQPGPQLILRPVEMRFSYQEAFQTASPTAYETLLWDIMQGDATLFTRADQVEAAWRLLMPILNVWETNPAIDFPNYHAGTWGPETAEVLIAHSGRSWLAPSLSEREG GT:EXON 1|1-507:0| BL:SWS:NREP 1 BL:SWS:REP 11->497|G6PD_SYNY3|e-128|47.0|485/509| PROS 187->193|PS00069|G6P_DEHYDROGENASE|PDOC00067| SEG 291->302|gryaargqygag| BL:PDB:NREP 1 BL:PDB:REP 12->498|1h93A|3e-79|34.4|477/485| RP:PDB:NREP 1 RP:PDB:REP 10->497|2dpgA|e-131|33.1|478/485| RP:PFM:NREP 2 RP:PFM:REP 15->197|PF00479|7e-41|46.7|180/181|G6PD_N| RP:PFM:REP 199->497|PF02781|3e-97|58.6|292/295|G6PD_C| HM:PFM:NREP 2 HM:PFM:REP 199->498|PF02781|2.9e-107|44.0|291/294|G6PD_C| HM:PFM:REP 15->197|PF00479|6e-59|42.3|182/183|G6PD_N| GO:PFM:NREP 6 GO:PFM GO:0004345|"GO:glucose-6-phosphate dehydrogenase activity"|PF00479|IPR001282| GO:PFM GO:0006006|"GO:glucose metabolic process"|PF00479|IPR001282| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00479|IPR001282| GO:PFM GO:0004345|"GO:glucose-6-phosphate dehydrogenase activity"|PF02781|IPR001282| GO:PFM GO:0006006|"GO:glucose metabolic process"|PF02781|IPR001282| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02781|IPR001282| RP:SCP:NREP 2 RP:SCP:REP 9->199|1dpgA1|1e-56|27.3|187/195|c.2.1.3| RP:SCP:REP 187->497|1qkiA2|e-108|36.3|289/297|d.81.1.5| HM:SCP:REP 2->207|1qkiA1|4.1e-55|43.0|193/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 187->498|1qkiA2|2.7e-147|57.9|290/298|d.81.1.5|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 1215 OP:NHOMOORG 842 OP:PATTERN -------------------------------------------------------------------- 2112311211111113322-23--222222221333115311133112232123222211222111123111111111----111---1111-1-------1--11-111111111111111111111111111-111111---112111111111111111111122131111111111111111--11-11122222-12-1211111-1111111111-1--111111121111111111221111111111111111111111111111111111-------1--11111111111-------------111---111--1----------------------1--------------1--1111------11111-1111211121111111111111111111-3323423212-12222221323111211111111111121111111123312---------------------------------11211-----2222223111122331111112232231--1111-11112121111-1211111111111121--1-1---111-1---------1--11112112-----------1-1-1111111-----11---1111-11112111111111111111111-12--111111111111111111111111-11111111111111111111111111111111111111111111111-1111-111111111111111------11112-111111111111111111----------4122223222233333212---------11111111111111111222222221111----------11111111-11---------------------------1--1-11121- 11--212-31111121111111111111111111111111211111111111111111111111111111131111111111111132-1211121111111133411313353331222222243132AF3-422-2122223-1222121-42212212122211321311222333c1112295791662121123 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 493 STR:RPRED 97.2 SQ:SECSTR #######ccccEEEEEETTTcHHHHHTHHHHHHHHHHTTcccccEEEEEEEcccccHHHHHHHHHHHHHHHHGGGcccHHHHHHHHTTEEEEEccTTcTTTHHHHHHHHHHHHHHTTccccEEEEEcccGGGHHHHHHHHHHTTcccccccEEEEEcccccccHHHHHHHHHHHTTTccGGGEEEccTTTTcTTGGGHHHHHHTcHHHHTTccTTTEEEEEEEEEcccccTTTHHHHHHHHHHHHTTTTHHHHHHHHHHccccccccHHHHHHHHHHHHTTcccccHHHHHHHEEEEEEcccccccTTcccGGGcTTcccccccccEEEEEEccccGGGTTccEEEEEEccccccEEEEEEEEccccccccccccTTcccccEEEEEEEcccEEEEEEEEEcccccccEEEEEEEEEccHHHHHHcccHHHHHHHHHHHTccTTcccHHHHHHHHHHHHHHHHHHHHTTcccEEEEcTTccccHHHHHHHHTTTcccccc####### DISOP:02AL 1-10, 504-507| PSIPRED cccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHcccHHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHcccEEEEEEEccccccccccccccccccccccccccEEEEEEEEccccccccEEEEEEcccccccEEEEEEEEEccccHHccccccccccccEEEEEEEcccEEEEEEEEcccccccEEEEEEEccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccEEEccccccccc //