[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58523.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->28 PF09086 * DUF1924 0.00019 42.3 26/98  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58523.1 GT:GENE ABA58523.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2373765..2374196) GB:FROM 2373765 GB:TO 2374196 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58523.1 GB:DB_XREF GI:76883842 LENGTH 143 SQ:AASEQ MGLSCASCHTLKGKARHVLSNNEVNPLVQDPANATNACRALTSQWEADHLWATFSSQVYKDRADAYEVAMRELLSPFRVSKINVLPVSAGPFPAGTPLTFVFSRDPETNVLLCDDIVENRGHYYGSELPEEDKEALISWLKRQ GT:EXON 1|1-143:0| HM:PFM:NREP 1 HM:PFM:REP 3->28|PF09086|0.00019|42.3|26/98|DUF1924| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccccccccHHHHHHHHHHHcccccccHHHcccccccHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcEEEEEccccccccccccEEEEEEccccccccccHHHHHHccccccccccHHHHHHHHHHHHcc //