[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58527.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->97 PF04600 * DUF571 4.9e-06 21.5 65/425  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58527.1 GT:GENE ABA58527.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2378825..2379169) GB:FROM 2378825 GB:TO 2379169 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58527.1 GB:DB_XREF GI:76883846 LENGTH 114 SQ:AASEQ MPEYVYIMLLSLFAGPARLDFMHPAFLRQRSRQFMVAFGGGALISAVALVLVSDGVSKLSPLTAALCLGAGGVFFYLLDMLLNQLKSSAGQLVAMLSDFIPEAIAFAVGESTGR GT:EXON 1|1-114:0| TM:NTM 3 TM:REGION 1->23| TM:REGION 32->54| TM:REGION 60->82| HM:PFM:NREP 1 HM:PFM:REP 30->97|PF04600|4.9e-06|21.5|65/425|DUF571| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11---------1---------------2-------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 112-114| PSIPRED ccHHHHHHHHHHHcccHHHHHccHHHHHHHHHHEEEEEccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //