[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58528.1
DDBJ      :             putative transposase gene of IS630 family insertion sequence ISY100d
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:RPS:PFM   3->52 PF01710 * Transposase_14 2e-04 38.0 %
:HMM:PFM   2->57 PF01710 * Transposase_14 1.1e-09 33.9 56/120  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58528.1 GT:GENE ABA58528.1 GT:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100d GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2379438..2379989 GB:FROM 2379438 GB:TO 2379989 GB:DIRECTION + GB:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100d GB:PROTEIN_ID ABA58528.1 GB:DB_XREF GI:76883847 LENGTH 183 SQ:AASEQ MALKAHAQQFPDLYLHERAAIFDVHTSSMGRMLKKLGIVKKERQYKERCLMKRQEFCKKLKAEHRMFGFKNLIDVDETGFDAPTPRPSSWAVKGCRIFGEITGQRKRRTNLLMAQRHGAKGREKEWLAPMLFKGSCNAQLFEMWVEQCLMKELHEPTIVVMDNSSFHNHKRVQDILAKGYLTI GT:EXON 1|1-183:0| RP:PFM:NREP 1 RP:PFM:REP 3->52|PF01710|2e-04|38.0|50/114|Transposase_14| HM:PFM:NREP 1 HM:PFM:REP 2->57|PF01710|1.1e-09|33.9|56/120|Transposase_14| OP:NHOMO 444 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------E-5-15L-----------O-3---3--------------------------------------------------------------------------------------------------------------------------1-1-121--------------33---444--------------------------------------------------2-----------------------------------4-----------------------1------------------------------------------2M------1---------3---------------------------------------------------------------------1---------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------1---------------------kv-c-muk---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHccccccHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccHHEEEEccccccccccccccHHHcccEEEEEEccccccccEEEEEEccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHccccc //