[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58529.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58529.1 GT:GENE ABA58529.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2380139..2380744) GB:FROM 2380139 GB:TO 2380744 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58529.1 GB:DB_XREF GI:76883848 LENGTH 201 SQ:AASEQ MLPVSFKIRSKVQLLYCLPMPPLTLATRLEGDLGERVFEQLRRLTEISCWHRSSYESDALWQLYAGACTSLGRLSASAATFRLEAQHKGEEFWGGNVKYVGLLHERLRINAIGKFWHKHMAFSSKREFRLRISLSFAEEFGVTVPEQRIRAPFDFDMLVDRIFLDPSLEPQDVQLTRKSAEMASLGDRVRVSSLLGTPRYT GT:EXON 1|1-201:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 200-201| PSIPRED cccccEEEcccEEEEEEcccccHHHHHHHccHHHHHHHHHHHHHHEEEHHccccccHHHHHHHHHHHHHHHHHHHHHEEEEEccHHHcccccccccEEEHHHHHHHHHHccccHHHHHHHccccccEEEEEEEEcccEEEcEEcccccEEccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEHHHHHcccccc //