[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58533.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->80 PF08423 * Rad51 0.0003 42.9 42/261  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58533.1 GT:GENE ABA58533.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2382400..2382771 GB:FROM 2382400 GB:TO 2382771 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58533.1 GB:DB_XREF GI:76883852 LENGTH 123 SQ:AASEQ MTPFIRRELTADGLNSLLGFIGWQRKMSCLLKAEAKVESFLSGLAVEWNVAVATQNQAMNDDDLQPYFKLGRPWGDKPIGELGGVIPLPPFLLPHSDHLTNPSSASHSSIIEPLSSNFYAFGF GT:EXON 1|1-123:0| HM:PFM:NREP 1 HM:PFM:REP 36->80|PF08423|0.0003|42.9|42/261|Rad51| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 103-104, 107-108| PSIPRED cccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccHHHHcccccccccHHHHccccccccccccccccccccccccHHHHHHHHHccEEEEcc //