[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58546.1
DDBJ      :             H+-transporting two-sector ATPase, C subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  78->152 1c99A_ f.17.1.1 * 9.4e-13 44.0 %
:HMM:PFM   85->150 PF00137 * ATP-synt_C 2.4e-19 45.5 66/66  
:HMM:PFM   4->97 PF02322 * Cyto_ox_2 1.4e-05 23.6 89/328  
:BLT:SWISS 117->148 ATPL_SULAC 3e-06 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58546.1 GT:GENE ABA58546.1 GT:PRODUCT H+-transporting two-sector ATPase, C subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2395567..2396022) GB:FROM 2395567 GB:TO 2396022 GB:DIRECTION - GB:PRODUCT H+-transporting two-sector ATPase, C subunit GB:PROTEIN_ID ABA58546.1 GB:DB_XREF GI:76883865 InterPro:IPR002379 LENGTH 151 SQ:AASEQ MYGLIILMGLSLVGLVGWGVFYEIRSRHPDFAAPRWWSSVVGVNVLVFVVAQVGLLFLVAQDAMAQEIATGEGAASPEISLGMGLALLAIGLPTAVATVAAGLAVGAVGSSALAAISEKPELFGRTLIYLGLAEGIAIYGVVVTILMLGKI GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 117->148|ATPL_SULAC|3e-06|50.0|32/101| TM:NTM 4 TM:REGION 2->24| TM:REGION 39->61| TM:REGION 88->110| TM:REGION 125->147| SEG 3->20|gliilmglslvglvgwgv| SEG 40->61|vvgvnvlvfvvaqvgllflvaq| SEG 81->92|lgmglallaigl| SEG 94->115|tavatvaaglavgavgssalaa| HM:PFM:NREP 2 HM:PFM:REP 85->150|PF00137|2.4e-19|45.5|66/66|ATP-synt_C| HM:PFM:REP 4->97|PF02322|1.4e-05|23.6|89/328|Cyto_ox_2| HM:SCP:REP 78->152|1c99A_|9.4e-13|44.0|75/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,39-39,67-67,73-74,76-76| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //