[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58551.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:348 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58551.1 GT:GENE ABA58551.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2400013..2401059) GB:FROM 2400013 GB:TO 2401059 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58551.1 GB:DB_XREF GI:76883870 LENGTH 348 SQ:AASEQ MTAPTFEFLASRQFTAWLAEQRVSLALTTYQAGKLFLLGLNPDGRLSVFNRTFARCMGLYATPSTLWMSSLYQLWRFENTLESGQNYQGFDRLFVPQLAYTTGDLDIHDIAPDGAGRPVFVSALFSCLATVSERYSFAPLWRPPFISKLAAEDRCHLNGLVMDEGQPRFVTAVSQSDVADGWRDHRTEGGVLIEVASGEVVLEGLSMPHSPRLYRGKLWLLDSGRGEFGYVDLERGRFEPVAFCPGYARGLSFIGDFAVVGLSLPRHDQSFSGLPLDERLQARHAEPRCGLQVIDINRGDGVHTLRISGVIEELYDVAVLPGVHRPMALGFRSDEIRRMISVAPGPAN GT:EXON 1|1-348:0| OP:NHOMO 27 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1-------------------------------------------1--------------------1------------------2-11--2--211--------2--12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1---------------------------------------------------------------------------------------------------------1---------------------------------------------1-1------------------------------------------------------------2------------------1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 346-348| PSIPRED ccccEEEEEEccHHHHHHHHcccEEEEEEEcccEEEEEEEccccEEEEEHHcccccEEEEEEccEEEEEEHHHEEEEcccHHHccccccccEEEEEEEEEEEccEEEEEEEEcccccEEEEEccEEEEEEEcccccEEEEEcccccccccccccEEEccEEEEccccEEEEEEEccccccHHHcccccccEEEEEccccEEEEcccccccccEEccEEEEEEcccEEEEEEEcccccEEEEEEcccHHHHHHHHccEEEEEEEEEEcccccccccccHHHHHHccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHHccccccEEEccccHHHEEEEEEcccccc //