[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58559.1
DDBJ      :             biotin biosynthesis protein, BioH
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  417/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->245 1m33A PDBj 1e-41 45.8 %
:RPS:PDB   1->255 3e3aB PDBj 1e-31 22.1 %
:RPS:SCOP  9->255 1c4xA  c.69.1.10 * 6e-30 21.7 %
:HMM:SCOP  1->255 1va4A_ c.69.1.12 * 4.9e-47 32.2 %
:RPS:PFM   78->239 PF00561 * Abhydrolase_1 2e-11 35.1 %
:HMM:PFM   38->241 PF00561 * Abhydrolase_1 2e-21 28.8 198/231  
:HMM:PFM   14->53 PF12146 * Hydrolase_4 0.00028 35.0 40/79  
:BLT:SWISS 13->254 BIOH_YERE8 4e-53 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58559.1 GT:GENE ABA58559.1 GT:PRODUCT biotin biosynthesis protein, BioH GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2413002..2413769) GB:FROM 2413002 GB:TO 2413769 GB:DIRECTION - GB:PRODUCT biotin biosynthesis protein, BioH GB:PROTEIN_ID ABA58559.1 GB:DB_XREF GI:76883878 InterPro:IPR000073 InterPro:IPR000379 InterPro:IPR003089 InterPro:IPR010076 LENGTH 255 SQ:AASEQ MTLQIVQRGAGPDLVLLHGWGFHSGVWAPLVDCLSTRFRLTLVDLPGHGGSDPLAQGRRLAAVAETVARVAPPQACWLGWSLGGLVALQAAIDFPRRVNKLVLVASTPRFVTAVDWPYGVAPEVLADFSVALQNDSVETLKRFVWLQTRGAERAKAVAQVLLAHFNAPYRPGIEGLEDGLALLQDSDLRVELETIPCPTLAIMGQRDPLVPPKVGAWLSAHLPQGQVFMIPRAGHAPFLSHGQVFKDIVSNFLQA GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 13->254|BIOH_YERE8|4e-53|46.2|240/258| BL:PDB:NREP 1 BL:PDB:REP 14->245|1m33A|1e-41|45.8|225/251| RP:PDB:NREP 1 RP:PDB:REP 1->255|3e3aB|1e-31|22.1|253/275| RP:PFM:NREP 1 RP:PFM:REP 78->239|PF00561|2e-11|35.1|154/211|Abhydrolase_1| HM:PFM:NREP 2 HM:PFM:REP 38->241|PF00561|2e-21|28.8|198/231|Abhydrolase_1| HM:PFM:REP 14->53|PF12146|0.00028|35.0|40/79|Hydrolase_4| RP:SCP:NREP 1 RP:SCP:REP 9->255|1c4xA|6e-30|21.7|240/281|c.69.1.10| HM:SCP:REP 1->255|1va4A_|4.9e-47|32.2|255/0|c.69.1.12|1/1|alpha/beta-Hydrolases| OP:NHOMO 718 OP:NHOMOORG 442 OP:PATTERN -------1---------------1-------------------1--------1-------------1- -1112---------22211-18--311111114657-377-243-1-------32-----212-1112122-----------11---1-------------1-2111-------------------11211-11-153354---42------1--11------12----1-------------211------2---------1----1-1----2--1-2---11------121--------------1---------------------------------------------------------------------------------------------------1--2--1-11-1--------1----1---33------225-211122121----------2-111211-2122----1115223-12----11-1211-12---------22--13--------------------------------14-12111131121211--1113-221121-453542--122113--21111-1-11111111111111111222-2-------1-----13111221121132----------------------------111111-11112111111112111121211421-12311-1----12111211111111111-11111111111111111112222144111111111111111112111111111111111111111--11111-1111111223---------------1112121-1-2123134466754564344---------1111211111211112212222222111111------11------------------------------------------1------ -------------------------------------------------1----------------------1-------------------------------------11-----------1----------21-1--1------1--1--1--------------------1-1--------4144-22------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccEEEEEEccTTccGGGGTTHHHHHHTTEEEEEEccTTcGGGTTcccccHHHHHHHHHHHHHcccEEEEEETHHHHHHHHHHHHcGGGEEEEEEEcccccccHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHccHHHHTcHHHHHHHHHHHHHccccccHHHHHHTTcccccccGGGGGGccccEEEEEETTcccccHHHHHHHHHHcTTEEEEEETTccTTHHHHcHHHHHHHHHHHHHH DISOP:02AL 255-256| PSIPRED cEEEEEEEccccEEEEEccccccHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHccHHHHEEEEEcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEEcccccccHHccHHHHHHHHHHHHcc //