[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58573.1
DDBJ      :             3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
Swiss-Prot:FABA_NITOC   RecName: Full=3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase;         EC=4.2.1.60;AltName: Full=Beta-hydroxydecanoyl thioester dehydrase;

Homologs  Archaea  0/68 : Bacteria  296/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->171 1mkaA PDBj 7e-61 62.0 %
:RPS:PDB   32->155 2bi0A PDBj 4e-17 8.9 %
:RPS:SCOP  1->171 1mkaA  d.38.1.2 * 5e-56 60.2 %
:HMM:SCOP  1->171 1mkaA_ d.38.1.2 * 1.1e-57 42.1 %
:RPS:PFM   32->152 PF07977 * FabA 2e-16 50.5 %
:HMM:PFM   30->158 PF07977 * FabA 3.1e-51 50.0 128/138  
:BLT:SWISS 1->171 FABA_NITOC e-101 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58573.1 GT:GENE ABA58573.1 GT:PRODUCT 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2431154..2431669 GB:FROM 2431154 GB:TO 2431669 GB:DIRECTION + GB:PRODUCT 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase GB:PROTEIN_ID ABA58573.1 GB:DB_XREF GI:76883892 InterPro:IPR010083 LENGTH 171 SQ:AASEQ MIRPSAFSYEDLLQCGRGEMFGPGNAQLPMPPMLMFDRITYISDEGGAFGKGEINAEMEIKPDSWFFNCHFPSDPVMPGCLGLDAMWQLLGFYLAWRGGPGHGRALGSGEVKFTGQVTPKNKLVTYHINLKRVIMRKLVMGIADGIMAVDGREIYLAKDLRVGLFVSTDSF GT:EXON 1|1-171:0| SW:ID FABA_NITOC SW:DE RecName: Full=3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase; EC=4.2.1.60;AltName: Full=Beta-hydroxydecanoyl thioester dehydrase; SW:GN Name=fabA; OrderedLocusNames=Noc_2113; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->171|FABA_NITOC|e-101|100.0|171/171| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| TM:NTM 1 TM:REGION 76->97| BL:PDB:NREP 1 BL:PDB:REP 6->171|1mkaA|7e-61|62.0|166/171| RP:PDB:NREP 1 RP:PDB:REP 32->155|2bi0A|4e-17|8.9|123/327| RP:PFM:NREP 1 RP:PFM:REP 32->152|PF07977|2e-16|50.5|111/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 30->158|PF07977|3.1e-51|50.0|128/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 1->171|1mkaA|5e-56|60.2|171/171|d.38.1.2| HM:SCP:REP 1->171|1mkaA_|1.1e-57|42.1|171/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 330 OP:NHOMOORG 297 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------11----------------------1-1-----------------------------------------------------------------------------------1--------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112222211111111111111111-111111111111111211111111111211111111111---------------------------------------------11--------------------------------------------1111----1----111----------------121-----------1111--1-1-----11----------------------------111-122111222222222222222222221-11111------11111111111111111-11111111111111111111111121111111111111111111111111111111111111111111111111----11111111111111111111----------1111111111111111111---------1111211111112111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 97.1 SQ:SECSTR #####cccHHHHHHHHTTccccHHTTccccTGGccTTcEEccccTcEEccHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTTTTTTccEEEEEEcEEccccccTEEEEEEEEEccccTTcccEEEEEEEEEEcTTccEEEEEEEHHTTEEcccTTc DISOP:02AL 1-5, 169-171| PSIPRED ccccccccHHHHHccccccccccccccccccccEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEcccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccEEEEEEEEEEEEEEcccccc //