[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58577.1
DDBJ      :             SSU ribosomal protein S15P
Swiss-Prot:RS15_NITOC   RecName: Full=30S ribosomal protein S15;

Homologs  Archaea  0/68 : Bacteria  792/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.16.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->89 1vs5O PDBj 1e-17 46.6 %
:RPS:PDB   6->88 3bbnO PDBj 4e-17 22.9 %
:RPS:SCOP  3->87 1a32A  a.16.1.2 * 5e-16 41.2 %
:HMM:SCOP  2->89 1g1xB_ a.16.1.2 * 1.5e-30 51.1 %
:RPS:PFM   6->87 PF00312 * Ribosomal_S15 3e-08 41.5 %
:HMM:PFM   7->88 PF00312 * Ribosomal_S15 1.1e-28 50.0 82/83  
:BLT:SWISS 1->89 RS15_NITOC 1e-35 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58577.1 GT:GENE ABA58577.1 GT:PRODUCT SSU ribosomal protein S15P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2439108..2439377) GB:FROM 2439108 GB:TO 2439377 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S15P GB:PROTEIN_ID ABA58577.1 GB:DB_XREF GI:76883896 InterPro:IPR000589 InterPro:IPR005290 LENGTH 89 SQ:AASEQ MSLSSERKVQVIKEHQCSVNDTGSPEVQVALLSERITQLSGHFKQHTHDHHSRQGLLRAVGQRRKLLDYLKKKDLDRYRTLINKLGLRR GT:EXON 1|1-89:0| SW:ID RS15_NITOC SW:DE RecName: Full=30S ribosomal protein S15; SW:GN Name=rpsO; OrderedLocusNames=Noc_2117; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|RS15_NITOC|1e-35|100.0|89/89| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 63->79|rrklldylkkkdldryr| BL:PDB:NREP 1 BL:PDB:REP 2->89|1vs5O|1e-17|46.6|88/88| RP:PDB:NREP 1 RP:PDB:REP 6->88|3bbnO|4e-17|22.9|83/85| RP:PFM:NREP 1 RP:PFM:REP 6->87|PF00312|3e-08|41.5|82/83|Ribosomal_S15| HM:PFM:NREP 1 HM:PFM:REP 7->88|PF00312|1.1e-28|50.0|82/83|Ribosomal_S15| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00312|IPR000589| GO:PFM GO:0005622|"GO:intracellular"|PF00312|IPR000589| GO:PFM GO:0005840|"GO:ribosome"|PF00312|IPR000589| GO:PFM GO:0006412|"GO:translation"|PF00312|IPR000589| RP:SCP:NREP 1 RP:SCP:REP 3->87|1a32A|5e-16|41.2|85/85|a.16.1.2| HM:SCP:REP 2->89|1g1xB_|1.5e-30|51.1|88/88|a.16.1.2|1/1|S15/NS1 RNA-binding domain| OP:NHOMO 792 OP:NHOMOORG 792 OP:PATTERN -------------------------------------------------------------------- -11-111111111111111-11111111111111111111111111111111111111111111111111111111111111111111---------------111----111111111111111111111111-111111----111-1111111111111111-11111111111111111---11111111111-1111111111-111111111111111111111111-11111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111----1-----1-11--111111111111--1111111111111111111111111111111111111-11111-11111-1111111111111111111111111111-1-111111111-11111111111111111111-111111111111111111111111111111111111111111111111111111-11111------1-111111111111111-111111111111111111111111111--11111111111111111111111-111111111111--1111111111111111----1----------111111111111111111111111111111111111111111111111-1111111111111111111-1-11----111111111-11-1----------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 98.9 SQ:SECSTR #cccHHHHHHHHHHHcccccccccTTHHHHHHHHHHTTTTTTTTTcTTccTTcHHHHHHHHHHHHHHTTHHHHccHHHHTTTTTTTccc DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccc //