[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58609.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.62.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->206 1dgqA PDBj 2e-06 10.1 %
:RPS:SCOP  40->206 1shtX  c.62.1.1 * 2e-04 13.6 %
:HMM:SCOP  35->210 1qc5A_ c.62.1.1 * 2.4e-07 20.6 %
:HMM:PFM   93->144 PF05762 * VWA_CoxE 8.2e-05 26.9 52/222  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58609.1 GT:GENE ABA58609.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2481017..2481733) GB:FROM 2481017 GB:TO 2481733 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58609.1 GB:DB_XREF GI:76883928 LENGTH 238 SQ:AASEQ MTEKTGKSLRKPSSSSEVDAFLKKVAAMPQIKPGSRHGRLIFAMDATASREPTWDRACHIQAQMFQETASLGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQHTQNETRKQKVNALVFVGDCMEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQIAQLTQGAYCRFDAASAAQLRDLLNAVAVYATGGRAALENFSQRQGGVTLRLIHQIKKD GT:EXON 1|1-238:0| RP:PDB:NREP 1 RP:PDB:REP 35->206|1dgqA|2e-06|10.1|168/188| HM:PFM:NREP 1 HM:PFM:REP 93->144|PF05762|8.2e-05|26.9|52/222|VWA_CoxE| RP:SCP:NREP 1 RP:SCP:REP 40->206|1shtX|2e-04|13.6|162/177|c.62.1.1| HM:SCP:REP 35->210|1qc5A_|2.4e-07|20.6|170/0|c.62.1.1|1/1|vWA-like| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11111--------------1--1--1---------------11---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 72.3 SQ:SECSTR ##################################cccEEEEEEEEccTTcHHHHHHHHHHHHHHHHHTccTTEEEEEEEEcccEEEEEcHHHHHHHccHHHHGGGcccccccccHHHHHHHHGGTccTTcEEEEEEEEcccccccccccGGGTTcEEEEEEETTTEETTcHHHHHHHHHHccccHHHHHEEEEccGGGHHHHHHHH################################ DISOP:02AL 1-19, 237-238| PSIPRED cccccccccccccccHHHHHHHHHHHcccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHcc //