[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58613.1
DDBJ      :             Pentapeptide repeat protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  125/915 : Eukaryota  43/199 : Viruses  1/175   --->[See Alignment]
b.80.8
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   123->225 2j8kA PDBj 6e-14 43.7 %
:RPS:PDB   122->228 2bm7C PDBj 2e-19 17.8 %
:RPS:SCOP  129->226 2j8iA1  b.80.8.1 * 4e-22 36.7 %
:HMM:SCOP  122->232 2bm5A1 b.80.8.1 * 2.4e-24 45.9 %
:RPS:PFM   188->225 PF00805 * Pentapeptide 5e-04 60.5 %
:HMM:PFM   126->159 PF00805 * Pentapeptide 2.2e-08 38.2 34/40  
:HMM:PFM   168->200 PF00805 * Pentapeptide 7.2e-11 54.5 33/40  
:HMM:PFM   198->228 PF00805 * Pentapeptide 1.7e-09 48.4 31/40  
:BLT:SWISS 124->228 YMO3_ERWST 5e-18 45.7 %
:TM
:REPEAT 3|160->178|180->198|200->218
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58613.1 GT:GENE ABA58613.1 GT:PRODUCT Pentapeptide repeat protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2487876..2488613) GB:FROM 2487876 GB:TO 2488613 GB:DIRECTION - GB:PRODUCT Pentapeptide repeat protein GB:PROTEIN_ID ABA58613.1 GB:DB_XREF GI:76883932 InterPro:IPR001646 LENGTH 245 SQ:AASEQ MKVKHDKSKAEFFPGLLKQDEGGYLWDDRRSGYDRRKFKRRRPPFEQRGKKDRRSPELPEIIRYRIARTQLRTQLEACQTSHSFKYRFIGAIILVIVVFLGVIVFLSPVRVVKNCDMLPRPGVNWSNCLLSGKDLAAVNLSGANLHNSSFAGADLRRISLASATLAYANMASANLAYADLSNAVLRSANLQSANLSHAKLDYADLSYANLLGANLEGASLRGVKLDHAVWPDQRECAPGSVGFCR GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 124->228|YMO3_ERWST|5e-18|45.7|105/295| TM:NTM 1 TM:REGION 87->109| NREPEAT 1 REPEAT 3|160->178|180->198|200->218| SEG 35->45|rrkfkrrrppf| SEG 88->106|figaiilvivvflgvivfl| BL:PDB:NREP 1 BL:PDB:REP 123->225|2j8kA|6e-14|43.7|103/181| RP:PDB:NREP 1 RP:PDB:REP 122->228|2bm7C|2e-19|17.8|107/180| RP:PFM:NREP 1 RP:PFM:REP 188->225|PF00805|5e-04|60.5|38/40|Pentapeptide| HM:PFM:NREP 3 HM:PFM:REP 126->159|PF00805|2.2e-08|38.2|34/40|Pentapeptide| HM:PFM:REP 168->200|PF00805|7.2e-11|54.5|33/40|Pentapeptide| HM:PFM:REP 198->228|PF00805|1.7e-09|48.4|31/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 129->226|2j8iA1|4e-22|36.7|98/98|b.80.8.1| HM:SCP:REP 122->232|2bm5A1|2.4e-24|45.9|111/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 522 OP:NHOMOORG 175 OP:PATTERN ----------------------------1------------------12-35-----1---------- -------------------------------------2-1---4-----------------1--1--------------------1-1-------------------------------------23213321411111-----1-ZKMJLKA8A441----1877BJGOI-----------------------------------1-------------------------3--------------------------------------------------------------------------------------------------------------------------------------------1--3113-------1------------------------1----11-1-------11-------2111---------------------331--1--111--------1------------1----------------1------1---------1------1-------11--1---------------------11-2-------1---------112------1A21--------------------------------2----1-------1------11------2-1-----------1-------------------------------1-----1--23122222222222221-------2----------1-----1-------------1--------------1-----------1-----1--1-1--------------------------1---------------------------------------------------------------------------- ----22------------------------------------------------------------------------------------------------------A12--11-1111--1--1-1-131-121--1111111111111--1-1-12--------11-2---------------1---21------- ----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 48.6 SQ:SECSTR #################################################################################################################ccTTcccTccEEEccccTTcccTTcEEEccEEEccccTTcccTTcEEEccEEETcEEEccccTTEEEEEEEccccEEEccccccEEEEEEEcTTcccTTcccTTcccTTcccTTcccTT############# DISOP:02AL 1-10, 31-55| PSIPRED ccccccccHHHHccccEEEEcccEEEccHHHHHHHHHHHHHcccHHHcccccccccHHccHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEccccccccEEEcccccccEEEccEEccccccccEEcccccccccc //