[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58621.1
DDBJ      :             Flagellar biosynthesis protein FliQ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->79 PF01313 * Bac_export_3 2e-06 51.2 %
:HMM:PFM   5->78 PF01313 * Bac_export_3 2.6e-30 64.9 74/76  
:BLT:SWISS 37->89 FLIQ_SALTY 4e-12 75.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58621.1 GT:GENE ABA58621.1 GT:PRODUCT Flagellar biosynthesis protein FliQ GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2496607..2496876) GB:FROM 2496607 GB:TO 2496876 GB:DIRECTION - GB:PRODUCT Flagellar biosynthesis protein FliQ GB:PROTEIN_ID ABA58621.1 GB:DB_XREF GI:76883940 InterPro:IPR002191 InterPro:IPR006305 LENGTH 89 SQ:AASEQ MTADIVLSLLRHSLELLALLLAVLLLPSLAVGVLVSMFQAATQINEMTLSFIPKLLAVLLTLGLAGPWMLQLVLDHSRQIFENIPTLIG GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 37->89|FLIQ_SALTY|4e-12|75.5|53/89| TM:NTM 2 TM:REGION 11->33| TM:REGION 56->78| SEG 6->36|vlsllrhslellalllavlllpslavgvlvs| SEG 55->66|llavlltlglag| RP:PFM:NREP 1 RP:PFM:REP 37->79|PF01313|2e-06|51.2|43/76|Bac_export_3| HM:PFM:NREP 1 HM:PFM:REP 5->78|PF01313|2.6e-30|64.9|74/76|Bac_export_3| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF01313|IPR002191| GO:PFM GO:0016020|"GO:membrane"|PF01313|IPR002191| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11--------11-11----------------111---1----------11-1---------------------------------------------------------------------------------------------1---------1111-11-----------------------------1---1111111111111111111111---------1111111-1111----------------1--------------------------1---------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 89-90| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //