[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58622.1
DDBJ      :             Flagellar transport protein FliP
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  498/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   62->254 PF00813 * FliP 2e-36 46.1 %
:HMM:PFM   62->254 PF00813 * FliP 2.5e-84 61.1 193/194  
:BLT:SWISS 38->258 FLIP_PSEAE 5e-56 48.4 %
:PROS 187->202|PS01060|FLIP_1
:PROS 235->247|PS01061|FLIP_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58622.1 GT:GENE ABA58622.1 GT:PRODUCT Flagellar transport protein FliP GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2496873..2497661) GB:FROM 2496873 GB:TO 2497661 GB:DIRECTION - GB:PRODUCT Flagellar transport protein FliP GB:PROTEIN_ID ABA58622.1 GB:DB_XREF GI:76883941 InterPro:IPR005837 InterPro:IPR005838 LENGTH 262 SQ:AASEQ MSKLMRRAKLSRYQGVWCLMLPGLLLLPMAAGWAAPGVPALAVTADGNGEQTYTVTLQILGLMTVLTLLPAAVMVMTSFTRIIVVFSILRQALGLAQTPSSQILIGLALFLTFFIMSPVLDKAYQEGVKPYFQEEISVTDALARVREPFHHFMIAQTRETDLKLFAEISGREAFESPEQVPFSLLVPAFITSELKTAFQIGFLLFIPFLIIDLVVASVLMAMGMMMLSPMLVSLPFKLLLFVLIDGWSLLMGTLASSFYVAS GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 38->258|FLIP_PSEAE|5e-56|48.4|221/255| PROS 187->202|PS01060|FLIP_1|PDOC00812| PROS 235->247|PS01061|FLIP_2|PDOC00812| TM:NTM 5 TM:REGION 20->42| TM:REGION 63->85| TM:REGION 100->122| TM:REGION 199->221| TM:REGION 234->256| SEG 19->37|lmlpgllllpmaagwaapg| SEG 198->235|fqigfllfipfliidlvvasvlmamgmmmlspmlvslp| RP:PFM:NREP 1 RP:PFM:REP 62->254|PF00813|2e-36|46.1|193/193|FliP| HM:PFM:NREP 1 HM:PFM:REP 62->254|PF00813|2.5e-84|61.1|193/194|FliP| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF00813|IPR005838| GO:PFM GO:0016020|"GO:membrane"|PF00813|IPR005838| OP:NHOMO 680 OP:NHOMOORG 499 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------1---1---1----1--------1-1------------------11111--------------------1-111111111111111--------------------1---------------------------------------------111111111111111111111111111111111111111111------------------------------------------------------------------------------------------11111111111111111111---111--11111111111111111111--11111111----113111111211211111111111-2222212221112111222111111-1111112222111--------1111-121--------------------------------111122213222432211-22113334131222111--112112111--12-111211141-------111-11111-1111111222211111111111-12-1-1111-1111111111111111111---13-111111111312131211121122221---111111111121122141221111111-2211221111212-11--1---2222133333333333333331-212-1231133333323333--2------1111--411-------------------------1122121112311111232---------1111211111331111122222223------111111111111111111--------------------------1-11111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 43-50, 168-179| PSIPRED ccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //