[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58623.1
DDBJ      :             Flagellar biosynthesis protein, FliO
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   78->158 PF04347 * FliO 7e-05 25.9 %
:HMM:PFM   78->159 PF04347 * FliO 3.8e-26 42.7 82/87  
:BLT:SWISS 79->159 FLIO_PSEAE 4e-06 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58623.1 GT:GENE ABA58623.1 GT:PRODUCT Flagellar biosynthesis protein, FliO GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2497658..2498149) GB:FROM 2497658 GB:TO 2498149 GB:DIRECTION - GB:PRODUCT Flagellar biosynthesis protein, FliO GB:PROTEIN_ID ABA58623.1 GB:DB_XREF GI:76883942 InterPro:IPR007442 LENGTH 163 SQ:AASEQ MNKSPYTFTTVIFLLLMFSGQVALAAGSPAQTRPIQEEEVPGGFVQAPNIPASTIATGEVLQMMIALVLVLGAIALVMWLLRRVQGLQRNNGTGLQILGGVSLGTRERAVLVQVGEQQLLVGVCPGQIRTLHVLETPVAIPQKPLKNPFAQHLNAVLKQGESP GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 79->159|FLIO_PSEAE|4e-06|33.3|81/100| TM:NTM 2 TM:REGION 7->29| TM:REGION 60->81| SEG 65->77|ialvlvlgaialv| SEG 110->123|vlvqvgeqqllvgv| RP:PFM:NREP 1 RP:PFM:REP 78->158|PF04347|7e-05|25.9|81/82|FliO| HM:PFM:NREP 1 HM:PFM:REP 78->159|PF04347|3.8e-26|42.7|82/87|FliO| GO:PFM:NREP 3 GO:PFM GO:0016021|"GO:integral to membrane"|PF04347|IPR007442| GO:PFM GO:0019861|"GO:flagellum"|PF04347|IPR007442| GO:PFM GO:0043064|"GO:flagellum organization"|PF04347|IPR007442| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 86-97, 140-148, 154-156, 159-163| PSIPRED cccccHHHHHHHHHHHHHcccEEEEEccccccccccHHcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccEEEEEEEccEEEEEEEEcccccEEEEccccccccccccccHHHHHHHHHHcccccc //