[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58624.1
DDBJ      :             Surface presentation of antigens (SPOA) protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  448/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.139.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->142 1yabB PDBj 9e-25 52.4 %
:RPS:SCOP  60->143 1o6aA  b.139.1.1 * 1e-22 51.2 %
:HMM:SCOP  58->144 1o6aA_ b.139.1.1 * 2.5e-24 54.0 %
:RPS:PFM   61->135 PF01052 * SpoA 1e-19 53.3 %
:HMM:PFM   62->134 PF01052 * SpoA 9.5e-25 37.0 73/77  
:BLT:SWISS 41->143 FLIN_PSEAE 2e-37 74.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58624.1 GT:GENE ABA58624.1 GT:PRODUCT Surface presentation of antigens (SPOA) protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2498146..2498577) GB:FROM 2498146 GB:TO 2498577 GB:DIRECTION - GB:PRODUCT Surface presentation of antigens (SPOA) protein GB:PROTEIN_ID ABA58624.1 GB:DB_XREF GI:76883943 InterPro:IPR001172 InterPro:IPR001543 LENGTH 143 SQ:AASEQ MSTHHNNQDPVAADEWADAPSQPQAGVDSGQEEESTSMFHPQAVLEELEADPGNVTKDINLELILDIPVTMAMEIGRTRISIRNLLQLNQGSVVELDRLAGEPLDVLVNGCLIAHGELVVVNEKFGIRLTDVISASERVKRLK GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 41->143|FLIN_PSEAE|2e-37|74.8|103/157| BL:PDB:NREP 1 BL:PDB:REP 61->142|1yabB|9e-25|52.4|82/87| RP:PFM:NREP 1 RP:PFM:REP 61->135|PF01052|1e-19|53.3|75/77|SpoA| HM:PFM:NREP 1 HM:PFM:REP 62->134|PF01052|9.5e-25|37.0|73/77|SpoA| RP:SCP:NREP 1 RP:SCP:REP 60->143|1o6aA|1e-22|51.2|84/87|b.139.1.1| HM:SCP:REP 58->144|1o6aA_|2.5e-24|54.0|87/87|b.139.1.1|1/1|Surface presentation of antigens (SPOA)| OP:NHOMO 525 OP:NHOMOORG 450 OP:PATTERN -------------------------------------------------------------------- 1-21------------------------------------1---1---1----1--------1-1--------------------111--------------------1------------------------------------1---------------------------------------------111---------------111111---1111111------11------------------------------------------------------------------------------------------12111111111111111111---111--21111112221112211111--11111111----112111111111111111111111-11111-2211111111111111111-111---1111-----------1111-132--------------------------------11111-111111211111111111112121111111--111111111--111111111121-------111-11111-1111111111111111111111-11-1-1222-2222222122222222222---12-111111111211111211121122221---1111-1111121111111111111111-1211211111112-11--1---111111111111111111111111-111121122222212222---------1111--211-------------------------1111111111211111111---------1111211111221111111111112------122222221111111111--------------------------1-11111-11-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 57.3 SQ:SECSTR ############################################################cHHHHTccccEEEEcccccccTTGGGTccTTccccccccccccEEEEETTEEEEEEEEEEETTEEEEEEEEEccHHHHHHHH# DISOP:02AL 1-12, 14-15, 18-62| PSIPRED cccccccccccHHHHHHHHcccccHHHHccccccccccccccHHHccccccccccccHHHHHHHHcccEEEEEEEEEEEEcHHHHHccccccEEEccccccccEEEEEccEEEEEEEEEEEccEEEEEEEEEEccHHHHHccc //