[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58647.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:200 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->67 PF06796 * NapE 3e-04 30.4 %
:HMM:PFM   46->84 PF01235 * Na_Ala_symp 1.2e-05 33.3 39/416  
:BLT:SWISS 45->109 ALST_BACSU 7e-04 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58647.1 GT:GENE ABA58647.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2526901..2527503 GB:FROM 2526901 GB:TO 2527503 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58647.1 GB:DB_XREF GI:76883966 LENGTH 200 SQ:AASEQ MTSKQNEMQELEEPESLEITDKDETKRSHRLTLDEYLFYGLILFSLIGVAISESSGGAGHLYWLAMVPMLAAASLYVEWAHAQLGTGVRWKTLLKTQLIHWGSLLVAVQLAYMLLQFGTLNEQNIGQVVLLLVAQTTFLMGIYVDWRFYVLGAFLALCLIVISYLEAYIWLLILIAIGIITLGLYLHRRFDISPHNRSRA GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 45->109|ALST_BACSU|7e-04|40.0|65/100| TM:NTM 4 TM:REGION 43->65| TM:REGION 95->117| TM:REGION 123->145| TM:REGION 158->180| SEG 7->18|emqeleepesle| SEG 167->186|ayiwlliliaigiitlglyl| RP:PFM:NREP 1 RP:PFM:REP 19->67|PF06796|3e-04|30.4|46/56|NapE| HM:PFM:NREP 1 HM:PFM:REP 46->84|PF01235|1.2e-05|33.3|39/416|Na_Ala_symp| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 194-200| PSIPRED ccccHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //