[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58648.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:287 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->141 1p3cA  b.47.1.1 * 4e-08 20.9 %
:HMM:SCOP  25->284 1agjA_ b.47.1.1 * 1.7e-08 20.2 %
:HMM:PFM   24->120 PF00089 * Trypsin 1.1e-08 25.3 83/219  
:BLT:SWISS 25->140 GSEP_BACLD 8e-04 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58648.1 GT:GENE ABA58648.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2527673..2528536) GB:FROM 2527673 GB:TO 2528536 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58648.1 GB:DB_XREF GI:76883967 LENGTH 287 SQ:AASEQ MNKRVTIEYQIKPGGKTVPKSFDIPFRWICRLVIEGKSATGILVGPRHVLTAAHVLDPHYRKGARLVNVEVLPAYDGSDSLGSYSSVSDLEVSKGWRAGKHKKSLDNGAYDYGMVILSNDNITTDRHKALEGKPLGYWGHPSQGHKTVFAPLGIQWLQSRINKRFFTAGYHKETKRAMQVRWGNIPGSGLVVPDGQGGVIPGRGMVFDALAPLEKRARGMSGGPIWYKVRSKRFSTRFMVGINTSAKKDGVTEIDEKGREHKKWQGYAARVTLEFFEEVSGWMHAKP GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 25->140|GSEP_BACLD|8e-04|30.6|98/100| SEG 75->90|ydgsdslgsyssvsdl| HM:PFM:NREP 1 HM:PFM:REP 24->120|PF00089|1.1e-08|25.3|83/219|Trypsin| RP:SCP:NREP 1 RP:SCP:REP 25->141|1p3cA|4e-08|20.9|110/215|b.47.1.1| HM:SCP:REP 25->284|1agjA_|1.7e-08|20.2|188/242|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 286-287| PSIPRED cccEEEEEEEEccccccccccccccEEEEEEEEEccccccEEEEccHHHEEHHHHccHHHHcccEEEEEEEEEccccccccccccEEEEEEccccccccccccccccccccEEEEEEEccccccccHHHHcccccccccccccccccHHHHccHHHHHHHHccEEEEcccccccccHHHHcccccccccEEEEccccccccccccHHHHHccHHHHcccccccEEEEEEEcccccccEEEEEEccccccccHHHHHcccccHHHccEEEEEEHHHHHHHHccccccc //