[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58657.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:161 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  27->128 1bxkA  c.2.1.2 * 4e-04 23.7 %
:HMM:PFM   47->154 PF01830 * Peptidase_C7 0.00043 21.6 97/243  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58657.1 GT:GENE ABA58657.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2541410..2541895 GB:FROM 2541410 GB:TO 2541895 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58657.1 GB:DB_XREF GI:76883976 LENGTH 161 SQ:AASEQ MPKGPGFVEYPAFESGYEALKRTTGNFRNLSPGPVIETVYRVPITLVVLRCMLGFTPPEWAYVTSQRTHVAVSQGAIRTIDRKIRMEPATPLRNRGGVTGERIRSLVTTACQILTEGAPEEPEEIIHRLNKADTSSGLASLQPLADLGVPYAMLLCNCSAS GT:EXON 1|1-161:0| HM:PFM:NREP 1 HM:PFM:REP 47->154|PF01830|0.00043|21.6|97/243|Peptidase_C7| RP:SCP:NREP 1 RP:SCP:REP 27->128|1bxkA|4e-04|23.7|97/341|c.2.1.2| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccEEcccHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHccccc //