[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58662.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:RPS:PFM   17->154 PF11220 * DUF3015 9e-34 53.6 %
:HMM:PFM   18->155 PF11220 * DUF3015 1.9e-59 56.5 138/144  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58662.1 GT:GENE ABA58662.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2546653..2547123) GB:FROM 2546653 GB:TO 2547123 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58662.1 GB:DB_XREF GI:76883981 LENGTH 156 SQ:AASEQ MRKVFLGLLLAAISGFAFADSGPGCGAGSVLFKGQDRLAPHVLAATTNASFGNQTFGMTTGTLGCDTSKPIDVMAANFFDQNMEQLATDMSRGEGEHLNALITLMKVQEADKDHFKATVKNQFSVIFPNQNVTSKEALSGLEKVMKGDTALAKYLS GT:EXON 1|1-156:0| RP:PFM:NREP 1 RP:PFM:REP 17->154|PF11220|9e-34|53.6|138/144|DUF3015| HM:PFM:NREP 1 HM:PFM:REP 18->155|PF11220|1.9e-59|56.5|138/144|DUF3015| OP:NHOMO 48 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------111--------1-----1-----------1-------1----------1-1--------------------------1----------------------------------------------------------------------------------------------------------11-1---------------111-11----1-2222111111111-111------------------------------------------11--22------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHc //