[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58679.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->53 3c3lB PDBj 3e-04 21.2 %
:HMM:PFM   49->81 PF04279 * IspA 0.00087 33.3 33/176  
:HMM:PFM   35->53 PF08026 * Antimicrobial_5 0.00099 47.4 19/39  
:BLT:SWISS 2->45 STAR9_HUMAN 3e-04 52.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58679.1 GT:GENE ABA58679.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2563476..2563784 GB:FROM 2563476 GB:TO 2563784 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58679.1 GB:DB_XREF GI:76883998 LENGTH 102 SQ:AASEQ MPVSMPFVQPSPGPPLERLDGQGPSAHPPGFRNASPRRGKSRTFPLLPAPYGPELHLIKILWRFIQYRWLLFSAFQSYANLKGALENRLANLMDVASAKKLA GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 2->45|STAR9_HUMAN|3e-04|52.3|44/100| RP:PDB:NREP 1 RP:PDB:REP 1->53|3c3lB|3e-04|21.2|52/1085| HM:PFM:NREP 2 HM:PFM:REP 49->81|PF04279|0.00087|33.3|33/176|IspA| HM:PFM:REP 35->53|PF08026|0.00099|47.4|19/39|Antimicrobial_5| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 53.9 SQ:SECSTR EETTEEEEEHHHHHHHHHHHHcccEEcHH#HHHHHHHHcHHHHHHHHccccccGGG############################################## DISOP:02AL 1-3, 16-40| PSIPRED cccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //