[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58688.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   148->258 PF07386 * DUF1499 3e-17 45.7 %
:HMM:PFM   117->259 PF07386 * DUF1499 1e-37 47.0 117/118  
:HMM:PFM   30->121 PF02322 * Cyto_ox_2 1.1e-05 18.2 88/328  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58688.1 GT:GENE ABA58688.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2573228..2574019 GB:FROM 2573228 GB:TO 2574019 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58688.1 GB:DB_XREF GI:76884007 LENGTH 263 SQ:AASEQ MKKDPLNSQQHSPQQPLDWVALLGITIASLSALAAVSSGFGHRLGAWHFTTGFLILRWASFGALAAIVLSLWGAFRTRPQRKRRGFWHALLGLALSLALVSIPLYWLLMARSVPPIHDITTDTDNPPAFSALLPVRAEAPNPSYYGGPSIAVQQQKAYPDIKPLRLPLNPKTTLDEALTIARSLGWKVIAVESRETAKGGIRLEATDTTLWFGFSDDVVVRITPFDDGSRVDIRSVSRVGRSDVGTNARRIRAFLAALKERAA GT:EXON 1|1-263:0| TM:NTM 3 TM:REGION 17->39| TM:REGION 51->73| TM:REGION 86->108| SEG 21->39|allgitiaslsalaavssg| SEG 89->99|allglalslal| RP:PFM:NREP 1 RP:PFM:REP 148->258|PF07386|3e-17|45.7|105/116|DUF1499| HM:PFM:NREP 2 HM:PFM:REP 117->259|PF07386|1e-37|47.0|117/118|DUF1499| HM:PFM:REP 30->121|PF02322|1.1e-05|18.2|88/328|Cyto_ox_2| OP:NHOMO 67 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111111111111111111111111-111-11111111111-------------11111--------------------------------------------------------1--1-----------------------------------------------1---------------------1-----------------1-1---1-------------------------------------11-1-1-111-------1---------------1-11----------------------------------------------------------------------------------------------------------1-----------------------1--------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 144-157, 262-263| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEEcccEEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcc //