[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58697.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->104 PF05175 * MTS 0.00025 28.7 87/170  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58697.1 GT:GENE ABA58697.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2585820..2586356) GB:FROM 2585820 GB:TO 2586356 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58697.1 GB:DB_XREF GI:76884016 LENGTH 178 SQ:AASEQ MVDNRRIRNGIVVLVGVFFLTACAGSKVSLTQPLAHSPQSISRIAIAPGSGVLGEAISVELFNRGLTVIDSNEATTILARAGLKEFEVTSSQGFAALQEKGIDAVPAAKAVDAKDGTPESASVRITNTSGGHIIAAITWQNGWGGQRGSVMDRVMRKNLSETANEIAGELIKRLNHNY GT:EXON 1|1-178:0| TM:NTM 1 TM:REGION 8->28| SEG 103->115|davpaakavdakd| HM:PFM:NREP 1 HM:PFM:REP 16->104|PF05175|0.00025|28.7|87/170|MTS| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 176-178| PSIPRED cccccHHHccHHHHHHHHHHHHHccccccccccccccccccEEEEEccccccccHHHHHEEHHcccEEEEccccEEHHHHcccccEEEcccccHHHHHHccccccccccccccccccccccEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //