[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58711.1
DDBJ      :             thiol-disulfide interchange protein DsbC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  283/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1d.17.3
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->239 1eejA PDBj 2e-43 41.1 %
:RPS:PDB   29->243 1eejA PDBj 1e-14 37.3 %
:RPS:SCOP  29->86 1t3bA2  d.17.3.1 * 1e-14 32.1 %
:RPS:SCOP  83->238 1v57A1  c.47.1.9 * 2e-12 21.3 %
:HMM:SCOP  26->87 1eejA2 d.17.3.1 * 5.5e-12 43.3 %
:HMM:SCOP  91->241 1t3bA1 c.47.1.9 * 6.7e-36 29.3 %
:RPS:PFM   30->81 PF10411 * DsbC_N 3e-13 48.1 %
:HMM:PFM   30->84 PF10411 * DsbC_N 1.7e-23 50.9 55/57  
:HMM:PFM   119->154 PF01323 * DSBA 0.00019 30.6 36/193  
:HMM:PFM   189->237 PF01323 * DSBA 6.5e-05 24.5 49/193  
:BLT:SWISS 18->239 DSBC_ECOLI 2e-43 39.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58711.1 GT:GENE ABA58711.1 GT:PRODUCT thiol-disulfide interchange protein DsbC GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2601970..2602707) GB:FROM 2601970 GB:TO 2602707 GB:DIRECTION - GB:PRODUCT thiol-disulfide interchange protein DsbC GB:PROTEIN_ID ABA58711.1 GB:DB_XREF GI:76884030 InterPro:IPR006662 LENGTH 245 SQ:AASEQ MGKKLLGFLLAGGLVTLSFSVVGDEEIKAVRASLQKLVPGVEPQSIKPAPIPGIYEVVLEGQVFYLSQDGRYMVQGQLVDLATRTNLTEERLKVIRAAAISDLDEQNMIVFGPKQAKHTVNVFTDIDCGYCRQLHQHIEEYNALGLKIRYLAFPRAGIGSSSYDKAVEVWCAKDPHQAMTQAKAGKSVEDTAKCENPVADQFKLGQSLGVNATPTLMLEDGTVLPGLVRPQALVNLLEQKVAAHP GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 18->239|DSBC_ECOLI|2e-43|39.9|213/236| SEG 2->14|gkkllgfllaggl| BL:PDB:NREP 1 BL:PDB:REP 29->239|1eejA|2e-43|41.1|202/216| RP:PDB:NREP 1 RP:PDB:REP 29->243|1eejA|1e-14|37.3|209/216| RP:PFM:NREP 1 RP:PFM:REP 30->81|PF10411|3e-13|48.1|52/56|DsbC_N| HM:PFM:NREP 3 HM:PFM:REP 30->84|PF10411|1.7e-23|50.9|55/57|DsbC_N| HM:PFM:REP 119->154|PF01323|0.00019|30.6|36/193|DSBA| HM:PFM:REP 189->237|PF01323|6.5e-05|24.5|49/193|DSBA| RP:SCP:NREP 2 RP:SCP:REP 29->86|1t3bA2|1e-14|32.1|56/59|d.17.3.1| RP:SCP:REP 83->238|1v57A1|2e-12|21.3|155/169|c.47.1.9| HM:SCP:REP 26->87|1eejA2|5.5e-12|43.3|60/60|d.17.3.1|1/1|DsbC/DsbG N-terminal domain-like| HM:SCP:REP 91->241|1t3bA1|6.7e-36|29.3|150/150|c.47.1.9|1/1|Thioredoxin-like| OP:NHOMO 338 OP:NHOMOORG 284 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------121-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--11111112211311112211111111121111211111122311121111112111111211111111413---------------211221212------2----------------------------11-111111111111111111121111111--21112------11111111111111211-1111111111111111111112111121111111111121111111111111-111111111111---1---------1111111111111111111133433332221111111111111111111---------111111112111111111121111111111---------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 88.2 SQ:SECSTR ############################HHHHHHHHT#TTccEEEEEEcccTTEEEEEETTEEEEEETTcccEEEcccEEccccccEEHHHHHHHHHHHHHTTGGTGcEEEccTTccEEEEEEEcTTcHHHHHHHTTHHHHHHTTEEEEEEEccTTccccHHHHHHHHHHTcccHHHHHHHHHTTcccccHccccccHHHHHHHHHHHTcccccEEEcTTccEEEccccHHHHHHHHHHHHHHHH DISOP:02AL 1-2, 242-245| PSIPRED ccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccEEEEcccccccEEEEEEccEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccHHcccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEcccccHHHHHHHHHHHHHccc //