[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58715.1
DDBJ      :             LSU ribosomal protein L19P
Swiss-Prot:RL19_NITOC   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->115 1vs6P PDBj 1e-45 75.2 %
:RPS:PDB   1->112 3bboR PDBj 1e-36 34.2 %
:RPS:SCOP  2->115 2j01T1  b.34.5.6 * 2e-40 50.0 %
:HMM:SCOP  3->116 2gyaN1 b.34.5.6 * 6.1e-43 65.8 %
:RPS:PFM   6->115 PF01245 * Ribosomal_L19 2e-33 72.7 %
:HMM:PFM   3->114 PF01245 * Ribosomal_L19 1.1e-53 68.8 112/113  
:BLT:SWISS 1->115 RL19_NITOC 1e-61 100.0 %
:PROS 87->102|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58715.1 GT:GENE ABA58715.1 GT:PRODUCT LSU ribosomal protein L19P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2605058..2605405) GB:FROM 2605058 GB:TO 2605405 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L19P GB:PROTEIN_ID ABA58715.1 GB:DB_XREF GI:76884034 InterPro:IPR001857 LENGTH 115 SQ:AASEQ MSNNIIKAIESEQLKQDLPEFCPGDTVQVQVRVKEGTRERLQAFEGVVIAKRNRGLNSSFTVRKISHGEGVERVFQTHSPTLESILVKRRGDVRRAKLYYLRERRGKAARIKEKI GT:EXON 1|1-115:0| SW:ID RL19_NITOC SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=Noc_2257; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|RL19_NITOC|1e-61|100.0|115/115| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 87->102|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 3->115|1vs6P|1e-45|75.2|113/114| RP:PDB:NREP 1 RP:PDB:REP 1->112|3bboR|1e-36|34.2|111/113| RP:PFM:NREP 1 RP:PFM:REP 6->115|PF01245|2e-33|72.7|110/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 3->114|PF01245|1.1e-53|68.8|112/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 2->115|2j01T1|2e-40|50.0|114/137|b.34.5.6| HM:SCP:REP 3->116|2gyaN1|6.1e-43|65.8|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 966 OP:NHOMOORG 932 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 -------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------11112E222113253-52--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR cccccTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEcccccEEEEEEEEEcccccHHHHEEccccccEEEEEEcc //