[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58724.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->171 2d4rA PDBj 2e-09 16.5 %
:RPS:SCOP  24->168 2pcsA1  d.129.3.10 * 6e-12 14.2 %
:HMM:SCOP  24->167 2d4rA1 d.129.3.6 * 6.5e-12 21.0 %
:HMM:PFM   26->169 PF10604 * Polyketide_cyc2 1.4e-07 28.3 127/139  
:BLT:SWISS 86->131 DUS11_HUMAN 5e-04 39.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58724.1 GT:GENE ABA58724.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2614548..2615066 GB:FROM 2614548 GB:TO 2615066 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58724.1 GB:DB_XREF GI:76884043 LENGTH 172 SQ:AASEQ MFSRAEAPGVQNLEVSRRYSGYIVNGQVRLQAPLEAVRAQLLNFNHMDRLHRCIQRSELQYCFPDGRHRVCVQVRFCIIRFGFALQSIQDFTWNKYTIQAVMLPEKGDFTHGKICWNLTPNGSEGTQLRFRVELIPAFWIPPLIGPCLLKRILLEKAREITQNLERLATMLP GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 86->131|DUS11_HUMAN|5e-04|39.1|46/100| RP:PDB:NREP 1 RP:PDB:REP 28->171|2d4rA|2e-09|16.5|133/144| HM:PFM:NREP 1 HM:PFM:REP 26->169|PF10604|1.4e-07|28.3|127/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 24->168|2pcsA1|6e-12|14.2|141/147|d.129.3.10| HM:SCP:REP 24->167|2d4rA1|6.5e-12|21.0|138/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 86.0 SQ:SECSTR #######################EEEEEEEcccHHHHHHHHHcHHHHGGGcTTEEEEEEEEEEEETTEEEEEEEEEEEEEETEEEEEEEEEEEETTTTEEEEEEEEEcccEEEEEEEEEEccTccEEEEEEEEEEcccTTTTTTTHHHHHHHHHTTHHHHHHHHHHHHHHH# DISOP:02AL 1-8| PSIPRED cccccccccccccEEccccccEEEccEEEEEcHHHHHHHHHHcccHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccEEEEEEccccccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //