[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58729.1
DDBJ      :             Type IV fimbrial biogenesis protein PilV
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  17->162 1oqwA_ d.24.1.1 * 2.1e-05 15.6 %
:HMM:PFM   15->33 PF07963 * N_methyl 3.1e-08 52.6 19/20  
:HMM:PFM   49->77 PF12279 * DUF3619 0.00011 41.4 29/131  
:PROS 15->35|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58729.1 GT:GENE ABA58729.1 GT:PRODUCT Type IV fimbrial biogenesis protein PilV GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2618406..2618954 GB:FROM 2618406 GB:TO 2618954 GB:DIRECTION + GB:PRODUCT Type IV fimbrial biogenesis protein PilV GB:PROTEIN_ID ABA58729.1 GB:DB_XREF GI:76884048 InterPro:IPR001120 LENGTH 182 SQ:AASEQ MNYSSEFPCLRPQPKGFSLLEVLVSVAVLSIGLLGLAGLQTTGIRHNHSAYLRSQATLLAYDITDRMRANRTAALNGGYTLDLGTPPVTPAKNCNAATCEPGELAAYDLYSWFQNVTAVLPSGDSKIELNSGVVTVTLQWDEKWTQRHKPKKNDGDDDDGDDGNNNSPPPSFTKRIVMSTEL GT:EXON 1|1-182:0| PROS 15->35|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 18->40| SEG 18->30|sllevlvsvavls| SEG 32->43|gllglaglqttg| SEG 153->166|ndgddddgddgnnn| HM:PFM:NREP 2 HM:PFM:REP 15->33|PF07963|3.1e-08|52.6|19/20|N_methyl| HM:PFM:REP 49->77|PF12279|0.00011|41.4|29/131|DUF3619| HM:SCP:REP 17->162|1oqwA_|2.1e-05|15.6|141/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------1---1----------------------------1--1--------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 145-169| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEEccHHHHHccccccccccccccccccccccHHHHHHHHHHccc //