[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58737.1
DDBJ      :             Sugar fermentation stimulation protein
Swiss-Prot:SFSA_NITOC   RecName: Full=Sugar fermentation stimulation protein homolog;

Homologs  Archaea  26/68 : Bacteria  340/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:235 amino acids
:PSIPRED
:RPS:SCOP  44->185 1t62A  b.122.1.4 * 3e-22 11.3 %
:RPS:PFM   14->227 PF03749 * SfsA 1e-58 54.8 %
:HMM:PFM   14->230 PF03749 * SfsA 3.1e-73 45.8 212/216  
:BLT:SWISS 1->235 SFSA_NITOC e-134 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58737.1 GT:GENE ABA58737.1 GT:PRODUCT Sugar fermentation stimulation protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2629625..2630332 GB:FROM 2629625 GB:TO 2630332 GB:DIRECTION + GB:PRODUCT Sugar fermentation stimulation protein GB:PROTEIN_ID ABA58737.1 GB:DB_XREF GI:76884056 InterPro:IPR005224 LENGTH 235 SQ:AASEQ MSFDQILLPGILRRRYQRFFADVALETGESIVAHCPNTGSMRGLAEPGLGVYVSRANNPRRKLAYTLELVDAHTSLVGVHTGRANILTKEAIAAGRISQLLGYGEIRQEVRYSKNSRIDLLLEDPSTQQCCYVEVKSVTLRQGDGAACFPDAVTTRGAKHLDDLAATVCSPRQRAVMFYLVQREDCRYFTPADDIDPRYGAKLRSAIEQGVEILAYACQVSSQGIQVTQSLPIHL GT:EXON 1|1-235:0| SW:ID SFSA_NITOC SW:DE RecName: Full=Sugar fermentation stimulation protein homolog; SW:GN Name=sfsA; OrderedLocusNames=Noc_2279; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|SFSA_NITOC|e-134|100.0|235/235| RP:PFM:NREP 1 RP:PFM:REP 14->227|PF03749|1e-58|54.8|210/216|SfsA| HM:PFM:NREP 1 HM:PFM:REP 14->230|PF03749|3.1e-73|45.8|212/216|SfsA| RP:SCP:NREP 1 RP:SCP:REP 44->185|1t62A|3e-22|11.3|133/153|b.122.1.4| OP:NHOMO 379 OP:NHOMOORG 375 OP:PATTERN -------111112211-111-11-----1---111--------------1-----1-111-111---- -----------------------------------------------------------------------------------11111------------------------------------------------111----11-1111111111111111111111111111111111111-----11-------------------11----------------------------------------------11---------11------------------------------------------------------111111111111111-111111-11--1-11-11-1--1111111-1-1---1111-1111-------------11111111111-111111111---1111--1---1111--111-----111-------------111-----------------------------1----------------------------------------------------------------------------111111111111111111111111-------1-------------------------1111-111111111111111111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1----------1111111111-11111111----------1111111111111111111----------11111111111111----------------1--------------------------------------------1--11-111--- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------1-1------1---------12111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccEEEEEEEEcccEEEEEEEccccEEEEEEccccccccHHccccEEEEEEccccccccEEEEEEEEEccEEEEEcccccHHHHHHHHHccccccccccccEEEEEEcccccEEEEEEEccccccEEEEEEEccEEEEcccEEEccccccHHHHHHHHHHHHHHHHccEEEEEEEEEEcccccEEEEHHHHcHHHHHHHHHHHHcccEEEEEEEEEcccEEEEccEEEEEc //